KEGG   Mycobacterium ulcerans: MUL_3015Help
Entry
MUL_3015          CDS       T00435                                 

Gene name
adhA
Definition
alcohol dehydrogenase AdhA
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mul  Mycobacterium ulcerans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MUL_3015 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MUL_3015 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    MUL_3015 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    MUL_3015 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MUL_3015 (adhA)
   00626 Naphthalene degradation
    MUL_3015 (adhA)
Enzymes [BR:mul01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MUL_3015 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(3340262..3341290)
Genome map
AA seq 342 aa AA seqDB search
MAAPASTPRMSAWQVRRPGPIDTGPLERVNVEVPRPAPSELLVAVRACGVCRTDLHVTEG
DLAVHRERVTPGHEVVGEVVEVGAEAGDEFAVGDRVGIAWLRHTCGVCKYCRRGDENLCP
KSLYTGWDADGGYAEFTTVPAAFAHHLPSGYSDSELAPLLCAGIIGYRSLLRAELPPGGR
LGLYGFGGSAHITAQVALAQGAEVHVMTRGAEARELALELGAASAQGAADPPPVPLDAAI
LFAPVGELVLPALAGLDRGGTLAVAGIHLSDIPPLNYQRHLFQERQIRSVTSNTRGDARA
FLNFAGQHHIEVTTPEYPLRQADRALSDLSAGRIAGAAVLIV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggccgcacccgcgagtaccccgaggatgagcgcatggcaggtgcgccggcccggtccc
atcgacaccggcccgctggagcgggtgaacgtcgaagtaccaagaccggcgccctccgaa
ctgctcgtggcggtgcgagcatgcggcgtgtgccgcaccgacctccacgtcaccgagggc
gatctggcggtgcaccgggagcgggtgacgccgggacatgaggtggtcggagaggtcgta
gaagtaggggccgaggccggcgacgagttcgccgtcggcgaccgggtgggcatcgcctgg
ctgcgccacacctgcggggtgtgcaagtactgccgccgtggcgatgagaacctgtgcccg
aagtccctctacaccggatgggacgctgacgggggatacgcagaattcaccaccgttccc
gcggcgtttgcccaccatctgcccagcggctacagcgatagcgagctggccccactgctg
tgcgccggcatcatcggttaccgctccctgctgcgggccgaactaccacccggcggcagg
ttgggcctgtatgggttcggcggcagcgcgcacatcaccgcacaggtcgcgttggcccag
ggagccgaggtgcatgtgatgacccgtggagccgaggcgcgtgagttggcactcgagctt
ggcgccgcatcggctcagggggccgccgacccaccaccggtaccgttggatgccgcgatc
ctgttcgccccggtaggggagctggtgttgccggctctggcgggcctcgaccgtggtggc
accctggcggtcgccgggattcatctcagcgacatcccgccgctgaactatcagcgtcac
ttgttccaggaacgtcagatcaggtcggtgacgtccaacacccgcggtgatgcccgggct
ttcctcaactttgcgggccagcatcatatcgaggtcaccacgcccgaatacccgctcagg
caggctgaccgcgcgctcagcgacctcagcgcgggccgcatcgccggcgccgcggtgttg
atcgtgtaa

DBGET integrated database retrieval system