KEGG   Mycobacterium ulcerans: MUL_3052Help
Entry
MUL_3052          CDS       T00435                                 

Definition
haloalkane dehalogenase
Orthology
K01563  
haloalkane dehalogenase [EC:3.8.1.5]
Organism
mul  Mycobacterium ulcerans
Pathway
Chlorocyclohexane and chlorobenzene degradation
Chloroalkane and chloroalkene degradation
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:mul00625]
Metabolism; Xenobiotics biodegradation and metabolism; Chlorocyclohexane and chlorobenzene degradation [PATH:mul00361]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(3378726..3379598)
Genome map
AA seq 290 aa AA seqDB search
MGRQFTPDFTPDPKLYPFASRWFDSSRGRLHYIDESDGPPILLCHGNPTWSFLYRHIIVA
LRDHFRCIAPDYLGFGLSEHPGTFGYKVDEHAQVVGEFVDHLGLDNYLTMGQDWGGPISM
AVAVERAERVRGIVLGNTWFWPADTLTMKAFSTVMSSLPMQYAILHHNFFVERLIPAGTT
HRPSSAVMEHYRGVQPTASARVGVAEMPKQILAARPLLARLASEVPAQLGTKPALLVWGM
KDFAFRPEPMLARMRAVFADHILVELPEAKHLIQEDAPDEIAAAIIARFG
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgggccggcaattcactccggatttcactccggatccgaagttgtacccattcgcatcg
cgctggttcgacagctcccgggggcgcctgcattacatcgacgagagcgacggcccgcca
atcctgctatgtcacggcaacccgacctggagtttcctgtaccgccacatcatcgtggcg
ctgcgggatcacttccgttgtatcgctccggactacctcggtttcggcctgtccgagcac
cccggcacgttcgggtacaaggtcgacgagcatgcgcaggtggttggcgagttcgtcgac
cacctgggtctggacaactacttgaccatgggccaggactggggcggaccgatcagcatg
gcggtcgcggtcgagcgcgccgaacgggtgcgcggaatcgtgttgggcaatacctggttc
tggccggccgacacgctgacgatgaaggcgttcagcaccgtgatgtccagccttcccatg
cagtacgcgatcttgcaccacaatttcttcgtggaacggctgattccggccggaacgacc
catcgcccgagtagcgcggtcatggagcactaccgtggcgtgcaaccaaccgcgtcagca
cgtgtgggtgtcgcggagatgcccaagcagatcctggccgcgcgtccattgctggccagg
cttgccagcgaggtgccggcacagctgggtaccaaacccgccctgctggtatggggtatg
aaggacttcgcattccggcccgagccgatgcttgcgcggatgcgcgcggtgttcgccgat
catatcctggtcgaactgcccgaggccaagcatctcatccaggaggatgcccccgacgag
atcgccgcggcgatcatcgcgcggttcggctga

DBGET integrated database retrieval system