KEGG   Mycobacterium ulcerans: MUL_3055Help
Entry
MUL_3055          CDS       T00435                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
mul  Mycobacterium ulcerans
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MUL_3055 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MUL_3055 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    MUL_3055 (glcB)
Enzymes [BR:mul01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MUL_3055 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(3382802..3384997)
Genome map
AA seq 731 aa AA seqDB search
MTDRVSAGNLRVARVLYDFVNNEALPGTDIDQDSFWAGVDKVVTDLTPQNQDLLKTRDDL
QAQIDKWHRHRVIEPLDPQAYREFLTEIGYLLPAPEDFTITTSGVDDEITTTAGPQLVVP
ILNARFALNAANARWGSLYDALYGTDVISESDGAEKGRGYNKVRGDKVIAYARQFLDDSV
PLAGASYTDATGFKVEDGQLVVSLADTSAALADPGQFAGYTGTAENPKSILLANHGLHIE
ILIDPESQIGATDGAGVKDVILESAITTIMDFEDSVAAVDADDKALGYRNWLGLNRGDLS
EDVTKDDKTFTRVLNTDRTYTAPHGGELTLPGRSLLFVRNVGHLMTNDAIVSDAEGAEGA
PVFEGIMDALFTGLIAIHGLRSTDANGLLTNSRTGSIYIVKPKMHGPAEVAFTCELFSRV
EDVLGLPQGTMKVGIMDEERRTTLNLKACIKAAADRVVFINTGFLDRTGDEIHTSMEAGP
MIRKGAMKNTAWIKAYEDANVDTGLAAGFSGKAQIGKGMWAMTELMADMVEQKIAQPKAG
ATTAWVPSPTAATLHAMHYHKVDVFAVQKELQGKTRTSVDELLTIPLAKELAWAPEEIRE
EVDNNCQSILGYVVRWIDQGVGCSKVPDIHNVALMEDRATLRISSQLLANWLRHGVITSE
DVRASLERMAPLVDKQNAGDPEYHAMAPNFDDSIAFLAAQDLILSGAQQPNGYTEPILHR
RRRELKARAGA
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgacggatcgcgtgtcggcggggaatttgcgcgtcgctcgggtgctctacgacttcgta
aacaacgaggccctgcccggcaccgacatcgaccaggacagcttctgggcgggcgtggac
aaggtggtcaccgacctcaccccgcagaaccaggatttgctgaagactcgcgatgatctg
caggcccagatcgacaagtggcatcgccaccgggtgatcgagccgttggacccgcaggcc
taccgcgagttcctcaccgagatcgggtacctgctgccggcacccgaggacttcaccatc
accacctccggggttgacgacgagatcaccacgaccgccggcccgcagctggtggtgccg
atcctcaacgcgcggttcgccctcaacgctgccaacgcccgctggggctcgctctacgac
gccttgtacggcaccgacgtcatctccgaaagcgacggcgccgaaaagggccggggctac
aacaaggtccgtggtgacaaggtaatcgcctacgcgcgccagttcctcgacgacagcgtg
ccgctggcgggggcctcctacaccgatgccacaggcttcaaggtggaagacggacagctg
gtggtgtcgctggcggacacgtccgcagcgctggccgatcccggccagttcgccggctac
accgggaccgccgagaaccctaagtcgatcctgctggccaatcacgggctgcacatcgag
atcctgatcgaccccgagtcgcagatcggtgccaccgacggcgccggcgtcaaggacgtg
atcctggagtccgccatcaccacgatcatggacttcgaggactcggtggccgcggtcgac
gctgacgacaaggcgctgggctatcggaactggctcggactgaaccggggcgatctgtcc
gaggacgtcaccaaggacgacaagaccttcacccgggtgctcaacaccgaccgcacctac
accgccccgcacggtggtgagctgaccttgcccggccgcagcctgttgttcgtccgcaac
gtgggccacctgatgaccaacgacgccatcgtttcggacgcggaaggcgccgagggcgcc
ccggtgttcgagggcatcatggatgcgctgttcaccggcctgatcgccatccacggtctg
cgaagcaccgatgccaacgggctgttgaccaacagccgcacgggctccatctacatcgtc
aagcccaagatgcacggtcccgccgaggtggcgttcacctgtgaattgttcagccgcgta
gaggacgtgctggggttgccgcaggggaccatgaaggtcggcatcatggacgaagagcga
cgtaccacgctcaacttgaaggcatgcatcaaggcggccgccgaccgggtggtgtttatc
aacaccggcttcctggaccgcaccggtgatgagatccacacctcgatggaagccggcccg
atgatccgcaagggcgcgatgaagaacacggcgtggatcaaggcctacgaggacgccaac
gtcgacaccgggctcgccgccggcttctccggtaaggcgcagatcggcaagggcatgtgg
gcgatgaccgaactgatggccgacatggtggagcagaagattgcccagccgaaggccggc
gcgaccaccgcgtgggtgccatcacccaccgcggccaccctgcacgcgatgcactatcac
aaggtggatgtctttgccgtgcagaaggagctgcagggcaagacccgcaccagcgttgac
gaattgctgaccattccgttggccaaggaactggcctgggcgcccgaggagatccgcgag
gaggtcgacaacaactgccagtccatcctcggttatgtggtgcgttggatcgaccagggc
gtcggctgttcgaaggttcccgacatccacaacgtggccctcatggaggaccgcgccacc
ctgcggatttccagccagttgctggccaactggctacggcatggcgtgatcaccagcgag
gatgtgcgggctagcctcgagcgcatggcaccgctggtggacaagcagaacgccggagat
cccgaataccacgcgatggcacccaatttcgacgacagcatcgcattcctggcggcccag
gatctgatcttgtcgggggcacaacagcccaacggatacacggagccgatcctgcaccgc
cgtcgtcgtgaattgaaggcacgcgctggtgcctga

DBGET integrated database retrieval system