KEGG   Mycobacterium ulcerans: MUL_3094Help
Entry
MUL_3094          CDS       T00435                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mul  Mycobacterium ulcerans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MUL_3094 (malQ)
Enzymes [BR:mul01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     MUL_3094 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
3437662..3439833
Genome map
AA seq 723 aa AA seqDB search
MTELAPSLVELARRYGIATEFQDWSGQCIPVSQDTLVAVLAALGVRADTEQQRNAALTEN
LRSYWTRSLPATIVSRAGAQTRFWAHVTHGAPADVWLQLEDGTLRGEVAQIDNFAAPFEL
DGRWIGEASFVLPTDLPIGYHRVYLRSHDYETSTALIITPDWLGLPEKLGNRRAWGLATQ
LYSVRSRRSWGIGDLTDLTDLALWSAYRHGADYVLVNPLHAAAPTAPMGPSPYLPTSRRF
FNPIYLRVEAIPEYADLPKRGRVRQLRENVQRGADQVAVIDRDGIWAAKRAALTLVHRVP
RSAGRELAYTAFCDRQGRALDDFATWCALAERYGDDWHRWPKPLQHPDASGIAAFATKHA
DAIDFHRWLQWQLDEQLAAAQSEATGAGMSLGIMHDLAVGVHPNGADAWALQDVLALGVT
AGAPPDEFNQLGQDWSQPPWRPDRLEQHEYQPFRALIQAVLRHSGGVRIDHIIGLFRLWW
IPEGAAPTEGTYVRYDHEAMIGIVALEAHRAGAVVVGEDLGTVEPWVRDYLLLRGLLGTS
ILWFELDRDGNGDPLPAERWREYCLSSVTTHDLPPTAGYLAGDHVRLRETLGLLTRPVEV
ELEAYRAERAAWLAELRRVGLLDEAAGAGVTAGPEDDPEQVVLALYRYLGRTPSRLLGVA
LTDAVGDRQTQNQPGTTDEYPNWRVPLAGPDGRQVLLEDIFSNARAARLANTVRDQTTPE
SIR
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgacggagcttgcgccctcgctggtcgaactcgcccgccggtacggcatcgccaccgag
ttccaggactggagcggccagtgcatacccgtctctcaggacactttggtggccgtgctg
gctgccctcggcgttcgggcggacaccgaacagcagcgcaacgccgccctgaccgagaac
ctgcggtcgtattggacgcgctcgttgccggcgaccatcgtctcgcgcgctggcgcgcaa
acgcgtttttgggcgcatgtcactcacggcgctccggccgacgtctggctgcagctcgag
gatggcacgctgcgtggcgaggtggcgcagatcgacaacttcgctgcgccgttcgagctg
gacggtcgctggatcggcgaagccagcttcgtgctgcctaccgatctgccgatcggctac
caccgggtgtatctgcgatcccacgactacgagaccagcacggccctcatcatcaccccg
gattggctggggctgccggaaaagctcggaaaccgtcgagcctggggcctggccacgcag
ctctatagcgttcgatcgcggcggtcctggggtatcggagacctgacggacctgactgat
ttggcgctctggtcggcctaccgccatggcgccgactatgtattggtcaacccgctgcat
gcggcggcaccgaccgcgcccatggggccctcgccctacctgccgacatcccggcgattc
ttcaatccgatctaccttcgtgtcgaggcgattccggaatacgccgatctacccaagcga
gggcgggtacgccaactgcgtgagaacgtgcaacggggggcggaccaggtcgccgtcatc
gaccgcgacgggatatgggcggccaagcgcgcagccctcaccctggtccaccgggtaccc
cgctcggcggggcgtgagctggcctataccgcgttctgcgaccggcagggccgagctttg
gatgacttcgccacctggtgcgcgctggccgagcggtacggcgatgactggcaccgttgg
ccgaagccgctgcagcatcccgatgcctctggcatcgcggctttcgcgaccaagcacgcg
gatgccatcgacttccaccggtggttgcagtggcaactcgacgagcagctagccgcggcg
cagtcggaagcgaccggtgccggcatgtcgctggggatcatgcatgacctcgccgtgggc
gttcaccccaacggggccgacgcgtgggccctacaggacgtgctggccttgggcgtcacc
gcgggcgcacccccggatgagttcaatcagctcgggcaggactggtcgcaaccgccatgg
cggccggaccgactcgagcagcatgagtaccagccgtttcgcgcgctcatccaggctgtg
ctgcggcactcaggcggggtccggatcgaccacatcatcgggctgttccggctctggtgg
attcccgagggagccgccccaaccgagggtacttatgtgcgctatgaccacgaggccatg
atcggcatcgtcgcgctggaagcgcatcgcgccggagctgtggtcgtcggcgaggatctc
ggcaccgtcgaaccttgggtgcgtgactacttactcctgcgcggcttgctgggcacctcg
atcttgtggtttgagctcgaccgggacggaaacggtgacccgcttccggccgaacgctgg
cgggagtactgcttgtcgtcggtaaccacgcacgatcttccgccgacagccggatacctg
gccggcgaccacgtgcgattgcgcgaaacgctggggctgttgacccgaccggtggaggtc
gaattggaggcataccgggcggagcgagccgcctggctagcggaattgcgccgcgttggc
ctactcgacgaagcggccggagccggcgtaacagccgggccggaagacgaccccgaacag
gtcgtgctcgcgttgtatcgctacctggggcggacaccgtcacggctgctgggggtggca
ctgaccgacgcggttggcgatcggcagacccaaaatcagccgggaaccacagacgagtat
ccgaactggcgagttccgctggccggccccgacggccgccaggtgctgctggaagacatc
ttcagcaatgccagggccgccaggctggccaacaccgttcgcgatcagacgacgccagaa
agtatccggtag

DBGET integrated database retrieval system