KEGG   Mycobacterium ulcerans: MUL_3208Help
Entry
MUL_3208          CDS       T00435                                 

Definition
hypothetical protein
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
mul  Mycobacterium ulcerans
Brite
Enzymes [BR:mul01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     MUL_3208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
3576126..3576878
Genome map
AA seq 250 aa AA seqDB search
MTIALAVAALVIIGGLFMQSPYGRFGATAGGVNLNPKLGWWLMEILATVVFAIFYLTGPQ
RFDAAPLVLAAIWLLHYGNRGWFFPLSIRQVPGKRSSFNISVLAAGMVITSMHGYLNGAF
FSHDYRHQYGTKWLTDPRFLLGTLVYLAGFVLLVWSESIVRNLRDKKNPGGTEYQIPYGG
GFRFVTSPAYLGELIAWAGFALLTWSLAGVAIFAITAGNLVPRAFATQKWYREKFPDYPA
ERKALIPGVI
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
ttgacgatcgccctggccgtcgcagcgttggtcatcatcggcggcttgtttatgcagagt
ccctatggtcgcttcggcgccaccgcgggcggggtgaatctgaacccgaagctgggctgg
tggctgatggagatcctggcaaccgtggtgttcgccatcttctatctcaccggcccacag
cgattcgatgccgcgccgctggtgcttgcggccatctggctgctgcactacggcaaccgg
ggctggttcttccccctgtcgatcaggcaggtgccgggaaagcgcagcagcttcaacatc
tcggtgctcgcggccggaatggtgatcacctcgatgcacggatatctcaacggggcgttc
ttcagccacgactaccggcatcagtacggcaccaagtggctgaccgatccgcggtttctg
ctcgggacgctcgtgtatctggccggattcgtcctgctggtctggtcggagtcgatcgtg
cgcaatctgcgggacaagaaaaacccgggtggcaccgagtaccagatcccctacggcggc
gggttccggttcgtcaccagtcccgcgtacttgggcgagctgatcgcctgggccgggttc
gccctgctgacctggtcgctggccggggttgccatctttgcgatcacggcaggcaatctg
gttccacgagcgttcgccacgcagaagtggtaccgcgagaagttccccgactaccccgcc
gagcgaaaagccttgatacccggggtgatctga

DBGET integrated database retrieval system