KEGG   Mycobacterium ulcerans: MUL_3340Help
Entry
MUL_3340          CDS       T00435                                 

Gene name
ppgK
Definition
(GenBank) polyphosphate glucokinase PpgK
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
mul  Mycobacterium ulcerans
Pathway
mul00010  Glycolysis / Gluconeogenesis
mul00520  Amino sugar and nucleotide sugar metabolism
mul01100  Metabolic pathways
mul01110  Biosynthesis of secondary metabolites
mul01120  Microbial metabolism in diverse environments
mul01130  Biosynthesis of antibiotics
mul01200  Carbon metabolism
Module
mul_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MUL_3340 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    MUL_3340 (ppgK)
Enzymes [BR:mul01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     MUL_3340 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ABL05526
Pasteur: MUL_3340
UniProt: A0PT57
Position
3711275..3712069
Genome map
AA seq 264 aa AA seqDB search
MTSTDPMAQTAGAAQPHRGFGIDVGGSGIKGAIVDLDTGQLIGERIKLATPQPATPSAVA
KTIAEVVDQIGWTGPLGVTYPGVVTHGIVQTAANLDKSWIGTNAREVISAELNGQDVTIL
NDADAAGLAEERYGAGNNQPGLVVLLTFGTGIGSAVINDGTLIPNTEFGHLEVGGKEAEQ
RAASSVKEKNDWSYEKWTKQVTRVLVAIENAIWPDLFIVGGGISRKADKWVHLLENRTPV
VAATLQNTAGIVGAAMASSTDVTH
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcaccgacccaatggcccaaaccgccggtgccgcacagccgcatcgcggattc
gggattgacgtcggcggcagcggcatcaaaggcgcgatcgtcgacctggacacgggccag
ctaatcggcgagcgcatcaagctggcgaccccgcagcccgcaactccgtcagcggttgcc
aagaccatcgccgaggtggtcgatcaaatcggctggaccggcccgctcggggtgacctat
ccgggcgtggtcacccacggcatcgttcagacggcggccaacttggacaagtcgtggatc
ggtaccaacgcgcgcgaggtcatcagcgccgaattgaacggccaggacgtgacgatcctc
aacgacgccgatgcggccgggctcgccgaggaacggtacggcgccgggaacaaccagccc
ggcctggtggtgctcctcaccttcggaaccggtatcgggtcggcggtcatcaacgacggc
acgctaatacccaacacagaatttggccatctcgaggtcggcggcaaggaggccgagcaa
cgggccgcgtcgtcggtcaaggagaaaaacgactggagctacgagaagtggaccaagcag
gtgacgcgggtcctggtggccatcgaaaacgcgatctggcctgaccttttcatcgtcggc
ggtggcatcagccgcaaggccgacaagtgggtgcacctgctggagaaccgcacgccggtg
gtggcggcgaccctgcagaacaccgccgggattgtcggcgcggcaatggcctccagcacc
gatgtgacgcactga

DBGET integrated database retrieval system