KEGG   Mycobacterium ulcerans: MUL_3340Help
Entry
MUL_3340          CDS       T00435                                 

Gene name
ppgK
Definition
polyphosphate glucokinase PpgK
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
mul  Mycobacterium ulcerans
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MUL_3340 (ppgK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MUL_3340 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    MUL_3340 (ppgK)
Enzymes [BR:mul01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     MUL_3340 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
3711275..3712069
Genome map
AA seq 264 aa AA seqDB search
MTSTDPMAQTAGAAQPHRGFGIDVGGSGIKGAIVDLDTGQLIGERIKLATPQPATPSAVA
KTIAEVVDQIGWTGPLGVTYPGVVTHGIVQTAANLDKSWIGTNAREVISAELNGQDVTIL
NDADAAGLAEERYGAGNNQPGLVVLLTFGTGIGSAVINDGTLIPNTEFGHLEVGGKEAEQ
RAASSVKEKNDWSYEKWTKQVTRVLVAIENAIWPDLFIVGGGISRKADKWVHLLENRTPV
VAATLQNTAGIVGAAMASSTDVTH
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcaccgacccaatggcccaaaccgccggtgccgcacagccgcatcgcggattc
gggattgacgtcggcggcagcggcatcaaaggcgcgatcgtcgacctggacacgggccag
ctaatcggcgagcgcatcaagctggcgaccccgcagcccgcaactccgtcagcggttgcc
aagaccatcgccgaggtggtcgatcaaatcggctggaccggcccgctcggggtgacctat
ccgggcgtggtcacccacggcatcgttcagacggcggccaacttggacaagtcgtggatc
ggtaccaacgcgcgcgaggtcatcagcgccgaattgaacggccaggacgtgacgatcctc
aacgacgccgatgcggccgggctcgccgaggaacggtacggcgccgggaacaaccagccc
ggcctggtggtgctcctcaccttcggaaccggtatcgggtcggcggtcatcaacgacggc
acgctaatacccaacacagaatttggccatctcgaggtcggcggcaaggaggccgagcaa
cgggccgcgtcgtcggtcaaggagaaaaacgactggagctacgagaagtggaccaagcag
gtgacgcgggtcctggtggccatcgaaaacgcgatctggcctgaccttttcatcgtcggc
ggtggcatcagccgcaaggccgacaagtgggtgcacctgctggagaaccgcacgccggtg
gtggcggcgaccctgcagaacaccgccgggattgtcggcgcggcaatggcctccagcacc
gatgtgacgcactga

DBGET integrated database retrieval system