KEGG   Mycobacterium ulcerans: MUL_3384Help
Entry
MUL_3384          CDS       T00435                                 

Definition
hypothetical protein
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
mul  Mycobacterium ulcerans
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MUL_3384
Enzymes [BR:mul01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     MUL_3384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
3754017..3754457
Genome map
AA seq 146 aa AA seqDB search
MTELTQTSQTSTDNIRTVEGFLSALQDADYEAANAALDDHLVYQNVGLPTIRGRSRAMRL
FRQMDGRMGFEVKIHRAAADGAAVLTERTDALILGPLRIHFWVCGVFEVHDGRITLWRDY
FDFYDMTKALLRGVAGAVIPALKARM
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagctgactcaaacaagccaaacaagcaccgacaacatccgcacggtcgagggc
ttcctgagtgcgcttcaggacgcggactacgaagcggcgaacgcggccctagacgaccac
ctggtgtaccagaacgtcggactgccgacgatccgtggccggagccgggcgatgcggctg
ttccgccagatggacgggcgcatggggttcgaggtgaagatccatcgcgccgccgccgat
ggagccgccgtactcaccgaacgcaccgatgcattgattctcggcccgctgcgaattcac
ttctgggtctgcggcgtgttcgaggtacacgacgggcgcatcacgctgtggcgcgactac
ttcgatttctacgacatgaccaaggcattgctgcgcggggtggccggcgcggtgatccca
gcgctgaaggcacgcatgtag

DBGET integrated database retrieval system