KEGG   Mycobacterium ulcerans: MUL_3575Help
Entry
MUL_3575          CDS       T00435                                 

Gene name
sucB
Definition
(GenBank) pyruvate dehydrogenase (E2 component) SucB
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mul  Mycobacterium ulcerans
Pathway
mul00020  Citrate cycle (TCA cycle)
mul00310  Lysine degradation
mul01100  Metabolic pathways
mul01110  Biosynthesis of secondary metabolites
mul01120  Microbial metabolism in diverse environments
mul01130  Biosynthesis of antibiotics
mul01200  Carbon metabolism
Module
mul_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mul_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MUL_3575 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    MUL_3575 (sucB)
Enzymes [BR:mul01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MUL_3575 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Trypan_PARP GCV_H
Motif
Other DBs
NCBI-ProteinID: ABL05720
Pasteur: MUL_3575
UniProt: A0PTQ1
Position
3963975..3965741
Genome map
AA seq 588 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDTVEIDEPLVEVSTDKVDTEIPSPAAGVLTKIV
AKEDDTVEVGGELAIIGDAAESGGGDAPSQPEPEAEPAAAAQPEPEAEPEPQPEAKPQSG
GSSTAGGDVTPVLMPELGESVAEGTVTRWLKKVGDSVQVDEALVEVSTDKVDTEIPSPVA
GVLLSITAEEDDVVQVGGELARIGSGSAAAAPPESKPAPAPEAAPETKAAPEPKAAPEPK
AAPEPKAAPEPKPAPAATPQPAAAPAPSAGDGTPYVTPLVRKLAEENNIDLDSVTGTGVG
GRIRKQDVLAAAEKKKERPEAKPAAAQASAPASPSKAAVPAAAAALAHLRGTKQKASRIR
QITAIKTRESLQATAQLTQTHEVDMTRIVALRARAKGSFAEREGVNLTFLPFIARAVIDA
LKIHPNINASYNEETKEITYYDAEHLGFAVDTDQGLLSPVIHNAGDLSLAGLARAIADIA
ARARSGNLKPDELSGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKRPRVVVDDTG
NESIGVRSVCYLPLTYDHRLVDGADAGRFLTTIKHRLEKGAFEADLGL
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggccttctcagtccagatgccggcactcggtgagagcgtcaccgagggaaccgtcacc
cggtggctcaagcaggagggcgacaccgtcgagatcgacgagccactagttgaggtttct
accgacaaggtcgacaccgaaattccctcgccggccgccggcgtgctgaccaagatcgtc
gccaaggaggacgacacggtcgaggtcggcggtgagctcgccatcatcggcgatgcggcc
gagagtggcggcggcgatgcgccgtcccaaccggagcccgaggccgagcccgccgcggcg
gctcagcccgaaccggaggccgagcccgagccgcaacccgaagccaaaccccaatccgga
ggctcgtcgactgctggtggcgacgtgaccccggtgctaatgcccgaactgggcgagtcg
gtggcggagggcaccgtaactcgctggctgaagaaggtcggggattcggttcaggtcgat
gaagcgctggtggaggtgtctaccgacaaggtggacaccgagatcccgtcaccggtggcc
ggcgtcctgctcagcatcaccgccgaggaggacgacgtcgtccaggtcggcggcgagttg
gcacggatcggctccggatctgcggccgccgcaccgcccgagtccaagccggcccccgcc
cccgaggcggcccccgaaaccaaggccgctcctgagcccaaggccgcgcccgagcccaag
gccgcgcccgagcccaaggccgcgcccgagcccaagcctgcgcccgcggcaacgccgcag
cccgcggccgccccggcaccaagtgcgggcgacggcaccccctacgtgactcccctggtc
cgaaaactggccgaggagaacaacatcgacctcgactcggtgaccggcaccggtgtcggc
ggtcgcatccgcaagcaagacgtattggccgctgccgagaagaagaaagagcgaccagag
gccaagccagcggctgctcaggcttcggctcccgcctcgccttcgaaggcggcagtcccg
gctgcggccgcggcgctggcacacctgcggggcaccaagcagaaggccagccggattcgg
cagatcaccgcgatcaagacccgcgaatccctgcaggcaaccgcgcagctcactcagacc
catgaggtcgacatgaccaggatcgtggcgctgcgggcccgggccaaggggtcctttgcc
gagcgggagggtgtgaacctgaccttcttgccgttcatcgcccgtgccgtgatcgacgcc
ctcaagatccacccgaacatcaacgccagctacaacgaggaaaccaaggagatcacctac
tacgacgccgagcacctcgggttcgccgtcgacaccgaccagggcctgctctcccccgtg
atccacaacgccggcgatctgtcgttggccgggctggcacgggcgatcgccgacatcgcc
gcccgcgctcgatcgggcaacctcaagcccgacgagttgtccggcggcacctttaccatc
accaacatcggcagccagggcgccttgttcgataccccgattctggtgccgccgcaggcc
gccatgttgggtaccggggcgatcgtgaaacgaccgcgagtggtcgtcgacgacaccggc
aacgaatcgatcggcgtccgctccgtgtgctacctcccgctgacctacgatcaccgcctg
gtcgatggtgctgatgcgggacgtttcctcaccaccatcaagcaccgcctcgaaaaggga
gctttcgaggccgacctggggctctga

DBGET integrated database retrieval system