KEGG   Mycobacterium ulcerans: MUL_3575Help
Entry
MUL_3575          CDS       T00435                                 

Gene name
sucB
Definition
(RefSeq) dihydrolipoamide acetyltransferase
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mul  Mycobacterium ulcerans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MUL_3575 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MUL_3575 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    MUL_3575 (sucB)
Enzymes [BR:mul01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MUL_3575 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
3963975..3965741
Genome map
AA seq 588 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDTVEIDEPLVEVSTDKVDTEIPSPAAGVLTKIV
AKEDDTVEVGGELAIIGDAAESGGGDAPSQPEPEAEPAAAAQPEPEAEPEPQPEAKPQSG
GSSTAGGDVTPVLMPELGESVAEGTVTRWLKKVGDSVQVDEALVEVSTDKVDTEIPSPVA
GVLLSITAEEDDVVQVGGELARIGSGSAAAAPPESKPAPAPEAAPETKAAPEPKAAPEPK
AAPEPKAAPEPKPAPAATPQPAAAPAPSAGDGTPYVTPLVRKLAEENNIDLDSVTGTGVG
GRIRKQDVLAAAEKKKERPEAKPAAAQASAPASPSKAAVPAAAAALAHLRGTKQKASRIR
QITAIKTRESLQATAQLTQTHEVDMTRIVALRARAKGSFAEREGVNLTFLPFIARAVIDA
LKIHPNINASYNEETKEITYYDAEHLGFAVDTDQGLLSPVIHNAGDLSLAGLARAIADIA
ARARSGNLKPDELSGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKRPRVVVDDTG
NESIGVRSVCYLPLTYDHRLVDGADAGRFLTTIKHRLEKGAFEADLGL
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggccttctcagtccagatgccggcactcggtgagagcgtcaccgagggaaccgtcacc
cggtggctcaagcaggagggcgacaccgtcgagatcgacgagccactagttgaggtttct
accgacaaggtcgacaccgaaattccctcgccggccgccggcgtgctgaccaagatcgtc
gccaaggaggacgacacggtcgaggtcggcggtgagctcgccatcatcggcgatgcggcc
gagagtggcggcggcgatgcgccgtcccaaccggagcccgaggccgagcccgccgcggcg
gctcagcccgaaccggaggccgagcccgagccgcaacccgaagccaaaccccaatccgga
ggctcgtcgactgctggtggcgacgtgaccccggtgctaatgcccgaactgggcgagtcg
gtggcggagggcaccgtaactcgctggctgaagaaggtcggggattcggttcaggtcgat
gaagcgctggtggaggtgtctaccgacaaggtggacaccgagatcccgtcaccggtggcc
ggcgtcctgctcagcatcaccgccgaggaggacgacgtcgtccaggtcggcggcgagttg
gcacggatcggctccggatctgcggccgccgcaccgcccgagtccaagccggcccccgcc
cccgaggcggcccccgaaaccaaggccgctcctgagcccaaggccgcgcccgagcccaag
gccgcgcccgagcccaaggccgcgcccgagcccaagcctgcgcccgcggcaacgccgcag
cccgcggccgccccggcaccaagtgcgggcgacggcaccccctacgtgactcccctggtc
cgaaaactggccgaggagaacaacatcgacctcgactcggtgaccggcaccggtgtcggc
ggtcgcatccgcaagcaagacgtattggccgctgccgagaagaagaaagagcgaccagag
gccaagccagcggctgctcaggcttcggctcccgcctcgccttcgaaggcggcagtcccg
gctgcggccgcggcgctggcacacctgcggggcaccaagcagaaggccagccggattcgg
cagatcaccgcgatcaagacccgcgaatccctgcaggcaaccgcgcagctcactcagacc
catgaggtcgacatgaccaggatcgtggcgctgcgggcccgggccaaggggtcctttgcc
gagcgggagggtgtgaacctgaccttcttgccgttcatcgcccgtgccgtgatcgacgcc
ctcaagatccacccgaacatcaacgccagctacaacgaggaaaccaaggagatcacctac
tacgacgccgagcacctcgggttcgccgtcgacaccgaccagggcctgctctcccccgtg
atccacaacgccggcgatctgtcgttggccgggctggcacgggcgatcgccgacatcgcc
gcccgcgctcgatcgggcaacctcaagcccgacgagttgtccggcggcacctttaccatc
accaacatcggcagccagggcgccttgttcgataccccgattctggtgccgccgcaggcc
gccatgttgggtaccggggcgatcgtgaaacgaccgcgagtggtcgtcgacgacaccggc
aacgaatcgatcggcgtccgctccgtgtgctacctcccgctgacctacgatcaccgcctg
gtcgatggtgctgatgcgggacgtttcctcaccaccatcaagcaccgcctcgaaaaggga
gctttcgaggccgacctggggctctga

DBGET integrated database retrieval system