KEGG   Mycobacterium ulcerans: MUL_3692Help
Entry
MUL_3692          CDS       T00435                                 

Gene name
nadD
Definition
bifunctional nicotinate-nucleotide adenylyltransferase NadD/hypothetical protein
Orthology
K00969  
nicotinate-nucleotide adenylyltransferase [EC:2.7.7.18]
Organism
mul  Mycobacterium ulcerans
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Module
NAD biosynthesis, aspartate => NAD
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:mul00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(4108811..4109845)
Genome map
AA seq 344 aa AA seqDB search
MGGTFDPIHYGHLVAASEVADRYELDEVVFVPSGQPWQKGRRVSPAEDRYLMTVIATASN
PRFSVSRVDIDRGGPTYTKDTLRDLHALNPAAELYFITGADALASIMSWQGWEQMFESAR
FVGVSRPGYELRHDHVTAALDGLAENALSLVEIPALAISSTDCRRRAAHGRPLWYLMPDG
VVQYVSKRRLYRTPPDSGGRGDPGHHDHSARGEQHMSATQEAIDMATVAAGAASAKLADD
VLVIDVSGQLVITDCFVIASASNERQVNAIVDEVEEKMRRAGYKLARREGAREGRWTLLD
YRDIVVHVQHQDDRSFYALDRLWADCPVVAVDLAEGSDDPAEAP
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgggtgggactttcgatcccatccattacggtcacctggtcgccgccagtgaggtagcc
gaccgctacgaactcgacgaggtcgtgttcgtgcccagcggacagccgtggcagaaggga
cggcgtgtttcgcctgccgaagaccgctatctgatgacggtcatcgcgacggcttccaac
ccccgcttttcggtcagccgggtcgacatcgaccggggcggtcctacctacaccaaggac
acgctgcgggatctgcatgccctcaacccggctgcggagctgtacttcatcaccggcgcc
gacgccctggcctcgatcatgtcctggcagggctgggagcagatgtttgagtcggcgcgg
tttgtcggagtgagtcggccgggctacgaactgcgccacgaccatgtcaccgccgcgctg
gacgggctcgccgagaacgccttgtccctggtggagatcccggcgctggcgatctcatcg
acggattgccgtcggcgcgccgcgcatggtcgccccctgtggtacctgatgcccgacggc
gtcgtgcagtatgtctcaaagcgcaggctctaccgcacgccaccggactcgggggggcgg
ggagaccctggacaccacgaccattctgcccgcggggaacaacacatgagcgctactcag
gaagccatcgacatggcgacggtggctgccggcgccgcgtcggccaaactggccgacgac
gtgctggtcatcgacgtgtccggccagctggtcatcaccgactgcttcgtgattgcttcg
gcgtccaacgagcgccaggtcaacgccatcgtcgacgaggtcgaggagaagatgcgccga
gccggctataagttggcgcgccgcgagggggcccgcgagggccgctggacgttgttggac
tatcgcgacatcgtggtccatgtccagcatcaggatgaccgcagtttttacgcactcgac
cggttgtgggccgactgcccggtggtggcggtggacttggcggagggctccgatgacccg
gcggaggcgccatga

DBGET integrated database retrieval system