KEGG   Mycobacterium ulcerans: MUL_3715Help
Entry
MUL_3715          CDS       T00435                                 

Gene name
rne
Definition
ribonuclease E Rne
Orthology
K08300  
ribonuclease E [EC:3.1.26.12]
Organism
mul  Mycobacterium ulcerans
Pathway
RNA degradation
Class
Genetic Information Processing; Folding, sorting and degradation; RNA degradation [PATH:mul03018]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(4140583..4143549)
Genome map
AA seq 988 aa AA seqDB search
MVDGAPSSDPENEPTQREDLPDRLRVHSLARTLGTSSRRVLDALSALDGRIRSAHSSVDR
VDAVRVRDLLAEQPAEEGQAEEDQQAPDAVAAEVPDAPGEPAEPESRLMLETQETVQVVE
TWVERPHYMPLFVAPQPISEPVAGDDADDESGDEGDDDEEQADRPGNRRRRRGRRGRGRG
RGEQGANDGQDQPGDDGDEAPQKAGGNSTSSDDSEAQDGADSEESDNGDDDNGSADGASR
RRRRRRRRKSGAGDDGDEGPAPDDPPNTVVHERAPRSGDKSGNSDSGDDSGGNEIKGIDG
STRLEAKRQRRRDGRDAGRRRPPVLSEAEFLARREAVERVMVVRDRVRTEPPHPGSRYTQ
IAVLEDGIVVEHFVTSAASASLVGNIYLGIVQNVLPSMEAAFVDIGRGRNGVLYAGEVNW
DAAGLGGADRKIEQALKPGDYIVVQVSKDPVGHKGARLTTQVSLAGRYLVYVAGASSTGI
SRKLPDTERQRLKEILREVVPSDAGVIIRTASEGVKEDDIRADVTRLQERWNQIEAKAVE
IKQKAAGAAVALYEEPDVLVKVIRDLFNEDFAGLVVSGDDAWDTINEYVSSVAPDLVSKL
SKYEPAVGSEGQVGPDVFAVHRIDEHLAKAMDRKVWLPSGGTLVIDRTEAMTVVDVNTGK
FTGSGGNLEQTVTKNNLEAAEEIVRQLRLRDIGGIVVIDFIDMVLESNRDLVLRRLTEAL
ARDRTRHQVSEVTSLGLVQLTRKRLGTGLIEAFSTSCPHCSGRGILLHADPVDSAPTTGR
KADSGGRRNRRSKKNRAEEPSEKEAVAKVPTYAPGEHPMFKAMAASSSSEAEHGDGEVEE
SGEELTAAVDDQTAVQVALDLGETEESEETDGTDETDDFDDDSDDSDDSDEDDDTDETND
TDVDADEDEDTDDDSDEDEDTEDDDELDDDLDDELDDDDSDSDDEDSESELTEPAAGRPA
ALEVTTIAERPRRRRAAGRPAGPPIHLG
NT seq 2967 nt NT seq  +upstreamnt  +downstreamnt
gtggtagacggtgccccatcttcagacccggaaaacgagccgacacagcgtgaggacctg
ccggaccgcctgagagttcactcactggcgcgaacgctgggaaccagtagccgtcgggtg
ctggatgcgttgagtgcgctcgatgggcggattcgcagcgcccattccagtgtggaccgc
gtcgatgcggtccgggtgcgcgacctgctggccgagcaacctgccgaggagggccaggcc
gaggaggaccagcaagctcctgacgccgtggccgctgaggtgcccgatgcgcccggcgaa
cccgccgagcccgaatcgcgcctgatgctggaaacccaggagacggtgcaggtcgtcgag
acctgggtggagcggccgcactacatgccgctgtttgtcgcaccccagccgatttcggag
cccgtcgctggcgacgatgccgatgacgagtcgggcgacgaaggtgacgatgacgaagag
caggccgaccggccgggcaaccggcgccgccgccggggtcggcgcgggcgcggccgcggg
cgcggcgagcagggcgcaaacgacggtcaggaccaacccggcgacgatggtgacgaggcc
ccgcagaaggcggggggcaactccacgtcatcggacgacagcgaggcgcaagacggcgct
gactccgaagagtcggacaacggcgacgacgacaacggttcggccgacggcgccagccgg
cgtcggcgccggcgccggcgccggaagtcgggtgctggtgatgacggcgacgagggtccg
gccccggatgacccgcccaacacggtcgtacacgagcgtgccccccgctccggcgacaag
tcgggcaactcggatagcggtgacgattccggtggcaacgagatcaagggcatagacggc
tcgacacggctggaagccaagcggcagcgccgccgcgacgggcgtgacgccggacggcgc
cgcccaccggtgttgagtgaggccgagttcttggctcgtcgcgaggcggtcgagcgggtg
atggtggtgcgcgaccgggttcgcaccgagccgccccacccgggctcgcgttacacccag
atcgcggtgcttgaagacggcatcgtcgttgagcactttgtgacctcggctgcttctgcc
tccctggtgggcaacatctacctggggatcgtgcagaacgtgctgccttcgatggaggcg
gcattcgtggatatcggtcgtggccgcaacggcgtgctctacgccggtgaagtcaactgg
gacgcggcgggcctcggcggggccgaccgcaagatcgaacaggctctcaagccaggcgac
tacatcgttgtgcaggtcagcaaggacccggtcggccacaagggtgcccgactgacgaca
caggtatcgctggcgggccgctatctggtgtacgtggcgggtgcgtcatcgaccgggatc
agccgcaagctgcccgacaccgaacgtcagcggctcaaggaaatcctgcgtgaggtggtg
ccctccgacgccggcgtgatcattcgaaccgcgtccgagggtgtcaaagaggacgacatc
cgtgcggacgtcacccggctgcaggagcgctggaaccagatcgaggccaaggccgtcgag
atcaaacagaaggccgcgggcgccgcggtagcgctctacgaagagcccgacgtgctggtc
aaggtcatccgggatctgttcaacgaagacttcgccgggctggtcgtatccggggacgac
gcgtgggacaccatcaacgagtacgtgagctctgttgcccctgatttggtttccaagctg
agcaagtacgaaccggccgtcgggtcggaggggcaggtcgggccggatgtctttgcggtg
catcgcatcgacgagcacctggccaaggcaatggatcgcaaggtgtggctgccctcgggc
ggcactctggtgatcgaccggaccgaagcgatgacggtggtcgacgtcaataccggcaag
ttcaccggttccggcggaaacctcgagcagacggtgaccaagaacaacctggaggccgcc
gaggagatcgtgcgccagctgcggctgcgcgacatcggtggcatcgtggtgatcgacttc
atcgatatggtgctggagtccaaccgtgacctggtgctgcgccggctgaccgaggcgttg
gcccgcgaccggacccgtcaccaggtgtcggaagtgacttcgctgggtctggtccaactg
actcgcaagcggttggggaccgggctgatcgaagccttctcaacctcctgtccgcactgc
agcggccgtgggattctgctgcatgccgacccggtggattcggcgccgacgactggacgt
aaagctgactcgggtggtcggcggaaccgccgatcgaagaagaaccgcgccgaagagccc
agcgagaaggaggccgtggccaaggttcccacctacgccccgggcgaacacccgatgttc
aaagccatggccgcgagttcgtcatcggaggccgagcacggtgacggggaagtcgaggag
tccggcgaggagttgaccgccgcggtcgacgaccaaaccgcggttcaggtggcccttgat
ctcggcgagaccgaagagtccgaagagaccgacgggaccgacgagaccgacgattttgat
gacgactcggacgactcggacgactcggacgaggacgacgacaccgacgagaccaacgac
accgacgttgacgccgatgaggacgaagacaccgacgacgactccgacgaggacgaagac
accgaagacgacgacgaactcgacgacgacctggatgacgagctggatgacgacgattcg
gatagcgacgacgaggatagtgagagcgaactcacagagccggctgctggccgtcccgca
gccctcgaggtcaccacgattgccgagcgcccgcgccggcggcgtgcggccggccggccg
gccggtccgcccatccatctgggctga

DBGET integrated database retrieval system