KEGG   Mycobacterium ulcerans: MUL_3715Help
Entry
MUL_3715          CDS       T00435                                 

Gene name
rne
Definition
ribonuclease E Rne
Orthology
K08300  
ribonuclease E [EC:3.1.26.12]
Organism
mul  Mycobacterium ulcerans
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:mul00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MUL_3715 (rne)
Enzymes [BR:mul01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.12  ribonuclease E
     MUL_3715 (rne)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(4140583..4143549)
Genome map
AA seq 988 aa AA seqDB search
MVDGAPSSDPENEPTQREDLPDRLRVHSLARTLGTSSRRVLDALSALDGRIRSAHSSVDR
VDAVRVRDLLAEQPAEEGQAEEDQQAPDAVAAEVPDAPGEPAEPESRLMLETQETVQVVE
TWVERPHYMPLFVAPQPISEPVAGDDADDESGDEGDDDEEQADRPGNRRRRRGRRGRGRG
RGEQGANDGQDQPGDDGDEAPQKAGGNSTSSDDSEAQDGADSEESDNGDDDNGSADGASR
RRRRRRRRKSGAGDDGDEGPAPDDPPNTVVHERAPRSGDKSGNSDSGDDSGGNEIKGIDG
STRLEAKRQRRRDGRDAGRRRPPVLSEAEFLARREAVERVMVVRDRVRTEPPHPGSRYTQ
IAVLEDGIVVEHFVTSAASASLVGNIYLGIVQNVLPSMEAAFVDIGRGRNGVLYAGEVNW
DAAGLGGADRKIEQALKPGDYIVVQVSKDPVGHKGARLTTQVSLAGRYLVYVAGASSTGI
SRKLPDTERQRLKEILREVVPSDAGVIIRTASEGVKEDDIRADVTRLQERWNQIEAKAVE
IKQKAAGAAVALYEEPDVLVKVIRDLFNEDFAGLVVSGDDAWDTINEYVSSVAPDLVSKL
SKYEPAVGSEGQVGPDVFAVHRIDEHLAKAMDRKVWLPSGGTLVIDRTEAMTVVDVNTGK
FTGSGGNLEQTVTKNNLEAAEEIVRQLRLRDIGGIVVIDFIDMVLESNRDLVLRRLTEAL
ARDRTRHQVSEVTSLGLVQLTRKRLGTGLIEAFSTSCPHCSGRGILLHADPVDSAPTTGR
KADSGGRRNRRSKKNRAEEPSEKEAVAKVPTYAPGEHPMFKAMAASSSSEAEHGDGEVEE
SGEELTAAVDDQTAVQVALDLGETEESEETDGTDETDDFDDDSDDSDDSDEDDDTDETND
TDVDADEDEDTDDDSDEDEDTEDDDELDDDLDDELDDDDSDSDDEDSESELTEPAAGRPA
ALEVTTIAERPRRRRAAGRPAGPPIHLG
NT seq 2967 nt NT seq  +upstreamnt  +downstreamnt
gtggtagacggtgccccatcttcagacccggaaaacgagccgacacagcgtgaggacctg
ccggaccgcctgagagttcactcactggcgcgaacgctgggaaccagtagccgtcgggtg
ctggatgcgttgagtgcgctcgatgggcggattcgcagcgcccattccagtgtggaccgc
gtcgatgcggtccgggtgcgcgacctgctggccgagcaacctgccgaggagggccaggcc
gaggaggaccagcaagctcctgacgccgtggccgctgaggtgcccgatgcgcccggcgaa
cccgccgagcccgaatcgcgcctgatgctggaaacccaggagacggtgcaggtcgtcgag
acctgggtggagcggccgcactacatgccgctgtttgtcgcaccccagccgatttcggag
cccgtcgctggcgacgatgccgatgacgagtcgggcgacgaaggtgacgatgacgaagag
caggccgaccggccgggcaaccggcgccgccgccggggtcggcgcgggcgcggccgcggg
cgcggcgagcagggcgcaaacgacggtcaggaccaacccggcgacgatggtgacgaggcc
ccgcagaaggcggggggcaactccacgtcatcggacgacagcgaggcgcaagacggcgct
gactccgaagagtcggacaacggcgacgacgacaacggttcggccgacggcgccagccgg
cgtcggcgccggcgccggcgccggaagtcgggtgctggtgatgacggcgacgagggtccg
gccccggatgacccgcccaacacggtcgtacacgagcgtgccccccgctccggcgacaag
tcgggcaactcggatagcggtgacgattccggtggcaacgagatcaagggcatagacggc
tcgacacggctggaagccaagcggcagcgccgccgcgacgggcgtgacgccggacggcgc
cgcccaccggtgttgagtgaggccgagttcttggctcgtcgcgaggcggtcgagcgggtg
atggtggtgcgcgaccgggttcgcaccgagccgccccacccgggctcgcgttacacccag
atcgcggtgcttgaagacggcatcgtcgttgagcactttgtgacctcggctgcttctgcc
tccctggtgggcaacatctacctggggatcgtgcagaacgtgctgccttcgatggaggcg
gcattcgtggatatcggtcgtggccgcaacggcgtgctctacgccggtgaagtcaactgg
gacgcggcgggcctcggcggggccgaccgcaagatcgaacaggctctcaagccaggcgac
tacatcgttgtgcaggtcagcaaggacccggtcggccacaagggtgcccgactgacgaca
caggtatcgctggcgggccgctatctggtgtacgtggcgggtgcgtcatcgaccgggatc
agccgcaagctgcccgacaccgaacgtcagcggctcaaggaaatcctgcgtgaggtggtg
ccctccgacgccggcgtgatcattcgaaccgcgtccgagggtgtcaaagaggacgacatc
cgtgcggacgtcacccggctgcaggagcgctggaaccagatcgaggccaaggccgtcgag
atcaaacagaaggccgcgggcgccgcggtagcgctctacgaagagcccgacgtgctggtc
aaggtcatccgggatctgttcaacgaagacttcgccgggctggtcgtatccggggacgac
gcgtgggacaccatcaacgagtacgtgagctctgttgcccctgatttggtttccaagctg
agcaagtacgaaccggccgtcgggtcggaggggcaggtcgggccggatgtctttgcggtg
catcgcatcgacgagcacctggccaaggcaatggatcgcaaggtgtggctgccctcgggc
ggcactctggtgatcgaccggaccgaagcgatgacggtggtcgacgtcaataccggcaag
ttcaccggttccggcggaaacctcgagcagacggtgaccaagaacaacctggaggccgcc
gaggagatcgtgcgccagctgcggctgcgcgacatcggtggcatcgtggtgatcgacttc
atcgatatggtgctggagtccaaccgtgacctggtgctgcgccggctgaccgaggcgttg
gcccgcgaccggacccgtcaccaggtgtcggaagtgacttcgctgggtctggtccaactg
actcgcaagcggttggggaccgggctgatcgaagccttctcaacctcctgtccgcactgc
agcggccgtgggattctgctgcatgccgacccggtggattcggcgccgacgactggacgt
aaagctgactcgggtggtcggcggaaccgccgatcgaagaagaaccgcgccgaagagccc
agcgagaaggaggccgtggccaaggttcccacctacgccccgggcgaacacccgatgttc
aaagccatggccgcgagttcgtcatcggaggccgagcacggtgacggggaagtcgaggag
tccggcgaggagttgaccgccgcggtcgacgaccaaaccgcggttcaggtggcccttgat
ctcggcgagaccgaagagtccgaagagaccgacgggaccgacgagaccgacgattttgat
gacgactcggacgactcggacgactcggacgaggacgacgacaccgacgagaccaacgac
accgacgttgacgccgatgaggacgaagacaccgacgacgactccgacgaggacgaagac
accgaagacgacgacgaactcgacgacgacctggatgacgagctggatgacgacgattcg
gatagcgacgacgaggatagtgagagcgaactcacagagccggctgctggccgtcccgca
gccctcgaggtcaccacgattgccgagcgcccgcgccggcggcgtgcggccggccggccg
gccggtccgcccatccatctgggctga

DBGET integrated database retrieval system