KEGG   Mycobacterium ulcerans: MUL_3936Help
Entry
MUL_3936          CDS       T00435                                 

Gene name
glgB
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mul  Mycobacterium ulcerans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MUL_3936 (glgB)
Enzymes [BR:mul01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     MUL_3936 (glgB)
Exosome [BR:mul04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MUL_3936 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
4395373..4397568
Genome map
AA seq 731 aa AA seqDB search
MSRTDQLAGTHLAPEPNDLALLVAGSHHNPHGVLGAHEYGDHIVIRAFRPHAAEVIAIVG
DDRFPMQHIESGLFAVALPFVDLIDYRLQVSYENSEPFTVADAYRFLPTLGEVDLHLFAE
GRHERLWEALGAHPRSFTTADGVVHGVSFAVWAPNAEGVSLIGDFNGWSGSEAPMRVLGS
SGVWELFWPDFPADGLYKFRVHGADGVVSERADPFAFGTEVPPQTASRVTVSDYSWGDGD
WMTERAQRNPVFEPMSTYEVHLGSWRPGLSYRQLATELTDYVVAHKFTHVELLPVAEHPF
AGSWGYQVTSYYAPTSRFGTPDDFRALVDALHQAGIGVIVDWVPAHFPKDAWALGRFDGT
PLYEHSDPKRGEQLDWGTYVFDFGRPEVRNFLVANALYWIEQFHIDGLRVDAVASMLYLD
YSRPQDGWTPNIYEGRENLEAVQFLQEMNATAHKAAPGIVTIAEESTSWPGVTRPTSIGG
LGFSMKWNMGWMHDTLDYVSRDPIYRSYHHHEMTFSMLYAFSENYVLPLSHDEVVHGKGT
LWGRMPGSNHTKAAGLRSLLAYQWAHPGKQLLFMGQEFGQRAEWSEQRGLDWFQLDENGF
SNGVLRLVRDINEIYCDHCALWSQDTTPEGYSWIDANDSANNVLSFLRHGSDGSVMACIF
NFAGSEHSDYRLGLPIAGRWREVLNTDATIYNGSGVGNFGGVDATAEPWHGRPASAVLVL
PPSSALWLEPA
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagaaccgaccaactcgccgggacgcacctggcgcccgaacccaacgacttggcg
ctcctagtcgccggttcacaccacaatccgcatggcgtcctgggcgcccacgagtacggc
gaccacattgtcatccgtgcgtttcggccgcacgcggcagaagtgatcgccatagtcggt
gacgaccggtttccgatgcagcacatcgagtctggcttgttcgccgtcgcgctgcccttt
gtcgacctcatcgactaccgactgcaagtcagctatgagaactcggagccgttcacggtt
gccgacgcgtaccgcttcctgcccaccctgggcgaggtggacctgcacctgttcgccgag
ggccgccatgagcgactctgggaggcgctcggcgcccacccccgctcgttcaccacagcc
gacggcgtggtccacggggtgtccttcgcggtgtgggctcccaacgccgagggggtcagc
ctgatcggcgacttcaacggatggagcggcagtgaggctcccatgcgggtgttgggttcc
tcgggggtgtgggaattattctggcccgacttccccgccgacgggctctacaagttccgg
gtacacggagccgacggtgtggtctcggagcgggccgacccgttcgccttcggcaccgaa
gtaccgccccagacggcatcgcgggtaaccgtaagcgactacagctggggcgacggcgac
tggatgaccgagcgtgcacaacgcaatccggtattcgagccgatgagcacctacgaggtc
cacctaggttcgtggcgacccggcctcagctatcgccagctcgccacggagctgacggat
tacgttgtggcacataagttcacccacgtagagctactccccgttgcagagcatccgttc
gccgggtcgtggggataccaggtcacgtcctactacgcgccgacatccaggttcggcacc
cccgacgacttccgagccttggtcgatgcactgcaccaagcgggcatcggggtaatcgtg
gactgggtgcccgcgcacttccccaaggatgcatgggccctagggcggttcgacgggaca
ccgctctacgaacactcggaccccaaaaggggtgagcaactagactggggaacttacgtt
ttcgatttcggccggcctgaggtgcgcaacttcctggtggccaacgcgttgtactggatc
gagcagttccacatcgatggcctgcgggtggacgcggtggcgtcgatgctgtatctggac
tactcccgcccgcaggacggctggacaccgaacatctacgaagggcgagagaacctggag
gcggtgcagttcctgcaggaaatgaatgccacagcgcacaaggcagcgccgggcatcgtc
accattgccgaggagtccacctcgtggcccggggtgactcgaccaaccagcattggcggc
ctgggcttctcgatgaaatggaacatgggctggatgcacgacacgctcgactacgtcagc
cgcgatcccatctatcgcagctaccaccatcacgagatgacgttctcgatgctgtacgcg
ttcagcgagaactacgtactgccgctgagtcacgatgaggtggtccacggcaaaggcacg
ttatggggccggatgccgggtagcaatcacaccaaggccgccggcttgcggagcctgctc
gcctaccaatgggcccaccccggcaagcaactgctgttcatgggacaggagttcggtcag
cgcgccgagtggtccgagcagcgcggcctggactggttccaactcgacgagaatggcttc
tctaatggcgttttgcgcttggtccgcgacatcaatgagatctactgcgaccattgcgca
ttgtggagtcaggacaccacccccgagggctattcctggatcgacgccaacgactcggcg
aacaatgtcttgagcttcctgcggcatggcagcgacggctcggtgatggcctgcatattc
aacttcgcgggttcagaacacagcgactatcgcctcggcctgccgatcgccggtcgttgg
cgtgaggtgctcaataccgacgcaacgatctacaacggctcaggagtcggtaatttcggc
ggcgtcgatgccaccgcggagccgtggcacggccgtccggcatccgcggtgctggtgctg
ccgccctcgtcggcgctgtggctggaacccgcctag

DBGET integrated database retrieval system