KEGG   Mycobacterium ulcerans: MUL_3976Help
Entry
MUL_3976          CDS       T00435                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
mul  Mycobacterium ulcerans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MUL_3976
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MUL_3976
   00620 Pyruvate metabolism
    MUL_3976
   00650 Butanoate metabolism
    MUL_3976
  Lipid metabolism
   00071 Fatty acid degradation
    MUL_3976
  Amino acid metabolism
   00350 Tyrosine metabolism
    MUL_3976
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MUL_3976
   00626 Naphthalene degradation
    MUL_3976
Enzymes [BR:mul01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MUL_3976
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MUL_3976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
4441115..4443784
Genome map
AA seq 889 aa AA seqDB search
MTTTPTESASPVEAPAIDNLRTAEIDAIVDTAAEAARAFRKLDQQQVDAIVEAMVRAGVR
AAGELAGVAIEETGFGVFEDKVVKNYVATEFLHDYLRGKKSVGVIDEDVEHNIVYVAEPI
GVVLGITPVTNPTSTVLFKAIVAAKTRNAILFRPSPYAVRCCEQSIEILRTAAEAAGMPP
GALQVIPDAAHEVTHYLFKHPKVDFIWVTGGPKIVALANSAGKPGLSVGPGNAPIYIHKT
ADLKGAVVDILISKTFDSSVICPAKQTCIIDDEIYDEMIAEFERMGAQLLTADQAKAVAE
FAFGCGDKVSLDAVGQKAPELAARAGFSVPPTVKVPLAQLPSDLDELAAHPLVQEKLMPV
LGVVRARSVQHGIDAAVLVTEHGGLGHTSAIYANDDDVIEAYGLAVRTGRILVNAPTAVG
ALGGVYNNLTPTFSLGCGTWGGSSTTENVNYRQLLNIKTVSRRRTPPQWFRVPSNTYFNE
GALDNLRELDCETVVVVTDALTEERGVVEALRGKLRAQHVQVFSEVTPEPDETTIRRGVA
LMQRVQPDLLIAIGGGSVLDAGKAMRLFYEHPEKSLDALTMPFLDPRKRVADYPTDRHRI
QLVAVPTTSGTGSEVSPAAVLTVGGKKETLVDYSLVPDLAIVDPVLTSSMPQKLTADIGI
DALTHALEAIVSIFASPYTDALCAQAVRLIFDALPRAYDDPDDLSARTSMSNAATLAGLA
FSNAFVGTNHTLAHAVGAKFSVPHGRANGIFLPHVLRYNASLPTKFMPAPGYSAYIAPDK
YAQLGQLVFGGHLPDDSRQRLFAGVDDLLDRLDMPRSLREFGVDEQGFLVALPTLAMTAF
EDLSNRTNPRMPLVSEITDLLRLGYYGDTGVGEPALAPIKPGDVDGRSV
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgacaccaaccgagtccgcctcccccgtcgaagcacccgcgatcgacaaccta
cgcaccgccgaaatcgacgccattgttgataccgccgctgaggcggcccgcgccttccgc
aagcttgaccagcagcaggtcgacgcgatcgtcgaggcgatggtgcgggccggggtgcgc
gcggccggcgaactggccggtgtggcgatcgaggagacgggcttcggcgtcttcgaggac
aaggtcgtcaagaactatgtggccaccgaattcctgcacgactatctgcgcggcaagaaa
tcggtgggcgtcatcgacgaggacgtcgagcacaacatcgtctatgtggccgaaccgatc
ggggtggtgctcggcattaccccggtgaccaacccgacctcgacggtgttgttcaaggcg
atcgtggccgcaaagacccgcaacgccattcttttccgaccgtcaccgtatgcggtgcgc
tgctgcgaacaaagcatcgagatcctgcgcaccgcggccgaagcggccgggatgcctccc
ggggcgctgcaggtcatccccgatgccgctcacgaggtgacgcactacttgttcaaacac
ccgaaggtcgacttcatctgggtgaccggcgggccaaagatcgtcgcgttggcgaactcg
gcaggaaagccggggctcagtgtcggtcctgggaatgcgccgatctacattcacaagacc
gcagacctcaagggcgcggtggtcgacatactcatctcgaaaacgtttgactcatcggtt
atctgcccggccaagcagacctgcatcatcgacgacgagatctacgacgagatgatcgcc
gagttcgagcggatgggggcccagttgctcaccgccgaccaggcgaaggcggtggccgag
ttcgcgtttggttgtggcgacaaggtctccctcgatgcggtcgggcagaaggcgccagaa
ctggccgcccgggccggattcagcgtgcctcccacggtgaaagtgccgctggcgcagttg
ccgtcggacttggacgaactcgccgcccacccactggtgcaggagaagctgatgccggtg
ctcggggtggtgcgcgcgcgcagtgtgcagcacggcatcgacgccgccgtcttggtcacc
gagcacggcgggttgggccatacctcggcgatctacgccaacgacgacgacgtcatcgag
gcatacgggttggcggttcgcaccggccgcatcctggtcaacgcgccaaccgcggtcgga
gcgctcggcggggtctacaacaatctgacacccacgttctcgctgggctgtggcacctgg
ggcggatcgagcaccaccgagaacgtcaactatcgccagttgctcaacatcaagacggtg
tcgcggcggcgcacgccgccgcaatggttccgcgtgccgtccaacacctacttcaacgaa
ggggcactggacaatctgcgcgagctcgactgcgagaccgtcgtggtggtaaccgacgca
ctgaccgaggagcgcggcgtggtggaggcgctgcgtggcaagttgcgcgcccagcacgtg
caggtgttcagcgaagtgacacccgagcccgacgagacgaccatccgccgcggtgtcgcg
ctcatgcagcgggtgcagcccgatctgctgatcgccatcggcggcggttcggtgctcgac
gccggcaaggcgatgcggctgttctacgagcacccggagaaaagcctcgacgctttgacg
atgcccttcctcgacccgcgcaagcgggtggctgactatccgaccgaccgtcatcgcatc
caactcgtcgctgtcccaacgacatcgggcactgggtcggaagtttcgccggcggcggtg
ttgaccgttggcgggaagaaggagacgctcgtcgactacagcttggtccccgacctggcg
atcgtggacccggtgctgacctcgtcaatgccgcagaagctgaccgcggacatcggcatc
gacgcgctgacccacgcgctggaggcgatcgtgtcgatcttcgcctcgccctacacggat
gcgttgtgcgcccaggcggtacggctgatcttcgatgccctgcccagggcgtacgacgat
cccgacgatctgtccgcccgaacgagcatgtccaatgcggcgacgcttgccggcctggcc
ttctcgaatgccttcgtcgggaccaatcataccctcgcccacgccgttggtgcgaaattc
tcggtcccccatggccgggcgaacggtatcttcctgccgcacgtgctgcgctacaacgca
agtctgcctaccaagttcatgcccgcgcctggatattcggcgtacatcgcaccggataaa
tacgcgcaactcggccagctggtgtttggtggccatcttcccgacgacagccgccagcga
ttgttcgcaggggtcgacgatctgctggaccgactggacatgccgagatcgctgcgggaa
ttcggggttgacgagcagggattcctggtcgcgctgccgacgctggcgatgaccgcgttc
gaggacctcagcaaccgcaccaacccgcggatgccgctggtcagcgagatcaccgatttg
cttcggctgggctactacggtgacaccggcgttggggagccggccctggcgccgatcaag
cccggggatgttgatggacggtccgtttag

DBGET integrated database retrieval system