KEGG   Mycobacterium ulcerans: MUL_4082Help
Entry
MUL_4082          CDS       T00435                                 

Gene name
ltp3
Definition
(GenBank) lipid carrier protein or keto acyl-CoA thiolase Ltp3
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mul  Mycobacterium ulcerans
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MUL_4082 (ltp3)
   00630 Glyoxylate and dicarboxylate metabolism
    MUL_4082 (ltp3)
   00640 Propanoate metabolism
    MUL_4082 (ltp3)
   00650 Butanoate metabolism
    MUL_4082 (ltp3)
  Lipid metabolism
   00071 Fatty acid degradation
    MUL_4082 (ltp3)
   00072 Synthesis and degradation of ketone bodies
    MUL_4082 (ltp3)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MUL_4082 (ltp3)
   00310 Lysine degradation
    MUL_4082 (ltp3)
   00380 Tryptophan metabolism
    MUL_4082 (ltp3)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MUL_4082 (ltp3)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MUL_4082 (ltp3)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MUL_4082 (ltp3)
Enzymes [BR:mul01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MUL_4082 (ltp3)
Exosome [BR:mul04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MUL_4082 (ltp3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
4551816..4552994
Genome map
AA seq 392 aa AA seqDB search
MAGARAQLAAVLGTGQTKYVAKRQDVSMNGLVREAIDRALQDSGSTFDDIDAVVVGKAPD
FFEGVMMPELFMADAMGASGKPLIRVHTAGSVGGSTGVVAASLVQSGKYRRVLAMAWEKQ
SESNAMWALSIPIPFIKPVGAGAGGYFAPHVRAYIRRSGAPSNIGAMVAVKDRLNGSRNP
LAHLQQPDITLDEVMQSPMLWDPIRYDETCPSSDGACAVVVGNEEIADARVADGHPVAWI
HATALRTEPLAYSGRDQVSPQAGRDTAAALWKAAGITSPIDEIDAAEIYVPFSWFEPMWL
ENLGFMPEGEGWKLTEAGETAIGGRLPVNPSGGVLSSNPIGASGLIRFAEAAIQVMGKGG
DHQVPNARKTLGHAYGGGSQYYSMWVVGADKP
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggccggagcccgagcacagctggccgcggtactaggtaccgggcagaccaagtatgtc
gccaagcgccaagatgtctcgatgaacggcctggtgcgcgaggctatcgatcgggcgctg
caagattccgggtcgacgttcgacgacatcgacgccgtcgtggtcggtaaggcgcccgat
ttcttcgagggcgtgatgatgccggagctgttcatggccgatgccatgggcgccagcggc
aagccgctgatccgggtgcacacggcgggctcggtgggcgggtccaccggtgtggtggcg
gccagcctggtccagtccggcaagtatcgccgcgtgctggcgatggcgtgggagaagcag
tcagagtccaacgccatgtgggccttgtcgattccgattcccttcatcaaaccggtcggc
gccggtgccggcggctatttcgccccacacgtgcgcgcctacatccgccgctccggagct
ccgtcgaacatcggcgcaatggtcgcggtgaaggaccggctcaacggcagccgcaacccg
ctcgcacatctacagcagccggacatcaccctcgacgaggtgatgcaatcaccgatgttg
tgggacccgatccgctacgacgagacctgcccgtcgtcggacggcgcctgcgccgtggtg
gtcggcaatgaggaaatcgccgatgcgcgcgttgccgatgggcacccggtggcatggatc
cacgcgaccgcactgcgcaccgaaccgctggcatactccggacgcgaccaagtcagcccc
caggccggccgtgacacggccgcggcgctgtggaaagcggccggaatcaccagtccgatc
gatgagatcgatgccgccgagatctatgtcccgttctcctggttcgaaccaatgtggttg
gaaaaccttgggtttatgcccgagggcgagggctggaagctcaccgaggccggtgagacc
gcgatcggcgggcggttgccggtgaacccgtccggcggcgtgctctcatccaaccccatc
ggcgcctcggggttgattcgtttcgccgaggcggctatccaggtgatgggcaagggcggc
gatcaccaagtgcccaatgcccggaaaaccctgggtcacgcatacggcggcggctcgcag
tattattccatgtgggtggtgggggccgacaagccatga

DBGET integrated database retrieval system