KEGG   Mycobacterium ulcerans: MUL_4096Help
Entry
MUL_4096          CDS       T00435                                 

Gene name
mhpF_1
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mul  Mycobacterium ulcerans
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mul00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mul00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:mul00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:mul00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:mul00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(4567443..4568369)
Genome map
AA seq 308 aa AA seqDB search
MPSKASVAIVGSGNISTDLLYKLLRSDWLEPRWMVGIDPQSEGLARARKLGLETTHEGVD
WLVAQSDKPDLVFEATSAYVHKAAAPKYAAAGIRAIDLTPAAVGPAVVPPANLREHLDAP
NVNMITCGGQATIPIVYAVSRAVADLGGVPYAEIVASVASVSAGPGTRANIDEFTKTTSK
GVETIGGARRGKAIIILNPADPPMIMRDTIFCAIPEDADRDAIAASIHEVVAQVQTYVPG
YRLLNEPQFDEPSINSGGQAVVTTFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKET
LAVSGGKR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcgaaggcaagtgtggccattgttgggtccggaaatatcagcaccgacctgctc
tacaaactgctgcgatccgactggctggaaccgcgctggatggtggggatcgacccgcag
agtgagggtttggcgcgggcccgcaagttgggcctggagaccacccacgagggcgtggat
tggctggtggcccagtcggacaagcccgatctggtgttcgaggcgaccagtgcctatgtg
cacaaggcggcggcgccgaagtatgcggccgccggaatccgggcgattgacttgacgccg
gcggcggtgggtcccgcggtggttccgccggccaacctgcgcgagcacctggatgccccc
aacgtcaacatgatcacctgtgggggacaggcgaccattccgatcgtgtacgcggtgtcg
cgagcggttgccgatctgggcggggttccctacgccgagatcgtggcgtcggtggcctcg
gtctcggcagggcccgggacccgggccaacatcgacgagttcaccaagaccaccagcaaa
ggtgtcgagacgatcggcggcgcccggcgcggtaaggcgatcatcattttgaacccggcc
gatccgccgatgatcatgcgggacacgatcttttgcgccatccccgaagacgccgaccgc
gacgcgatcgcggcctcgattcatgaggtcgtggcccaggtgcagacctatgtgcccggg
taccggttgctcaacgagccgcagttcgacgagccgtcgatcaactccggtggccaggcg
gtggtgaccacgttcgtcgaggtcgaaggcgctggcgattatctgccgccctacgcgggc
aatctggacatcatgaccgcggcggcgaccaaggtcggcgaggagatcgccaaggagacg
ctggccgtgtcaggaggaaagcgatga

DBGET integrated database retrieval system