KEGG   Mycobacterium ulcerans: MUL_4096Help
Entry
MUL_4096          CDS       T00435                                 

Gene name
mhpF_1
Definition
(GenBank) acetaldehyde dehydrogenase, MhpF_1
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mul  Mycobacterium ulcerans
Pathway
mul00360  Phenylalanine metabolism
mul00362  Benzoate degradation
mul00620  Pyruvate metabolism
mul00621  Dioxin degradation
mul00622  Xylene degradation
mul00650  Butanoate metabolism
mul01100  Metabolic pathways
mul01120  Microbial metabolism in diverse environments
mul01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MUL_4096 (mhpF_1)
   00650 Butanoate metabolism
    MUL_4096 (mhpF_1)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    MUL_4096 (mhpF_1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MUL_4096 (mhpF_1)
   00622 Xylene degradation
    MUL_4096 (mhpF_1)
   00621 Dioxin degradation
    MUL_4096 (mhpF_1)
Enzymes [BR:mul01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MUL_4096 (mhpF_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA DUF4620
Motif
Other DBs
NCBI-ProteinID: ABL06142
Pasteur: MUL_4096
UniProt: A0PUX3
Position
complement(4567443..4568369)
Genome map
AA seq 308 aa AA seqDB search
MPSKASVAIVGSGNISTDLLYKLLRSDWLEPRWMVGIDPQSEGLARARKLGLETTHEGVD
WLVAQSDKPDLVFEATSAYVHKAAAPKYAAAGIRAIDLTPAAVGPAVVPPANLREHLDAP
NVNMITCGGQATIPIVYAVSRAVADLGGVPYAEIVASVASVSAGPGTRANIDEFTKTTSK
GVETIGGARRGKAIIILNPADPPMIMRDTIFCAIPEDADRDAIAASIHEVVAQVQTYVPG
YRLLNEPQFDEPSINSGGQAVVTTFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKET
LAVSGGKR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcgaaggcaagtgtggccattgttgggtccggaaatatcagcaccgacctgctc
tacaaactgctgcgatccgactggctggaaccgcgctggatggtggggatcgacccgcag
agtgagggtttggcgcgggcccgcaagttgggcctggagaccacccacgagggcgtggat
tggctggtggcccagtcggacaagcccgatctggtgttcgaggcgaccagtgcctatgtg
cacaaggcggcggcgccgaagtatgcggccgccggaatccgggcgattgacttgacgccg
gcggcggtgggtcccgcggtggttccgccggccaacctgcgcgagcacctggatgccccc
aacgtcaacatgatcacctgtgggggacaggcgaccattccgatcgtgtacgcggtgtcg
cgagcggttgccgatctgggcggggttccctacgccgagatcgtggcgtcggtggcctcg
gtctcggcagggcccgggacccgggccaacatcgacgagttcaccaagaccaccagcaaa
ggtgtcgagacgatcggcggcgcccggcgcggtaaggcgatcatcattttgaacccggcc
gatccgccgatgatcatgcgggacacgatcttttgcgccatccccgaagacgccgaccgc
gacgcgatcgcggcctcgattcatgaggtcgtggcccaggtgcagacctatgtgcccggg
taccggttgctcaacgagccgcagttcgacgagccgtcgatcaactccggtggccaggcg
gtggtgaccacgttcgtcgaggtcgaaggcgctggcgattatctgccgccctacgcgggc
aatctggacatcatgaccgcggcggcgaccaaggtcggcgaggagatcgccaaggagacg
ctggccgtgtcaggaggaaagcgatga

DBGET integrated database retrieval system