KEGG   Mycobacterium ulcerans: MUL_4107Help
Entry
MUL_4107          CDS       T00435                                 

Gene name
fadA5
Definition
(GenBank) acetyl-CoA acetyltransferase FadA5
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mul  Mycobacterium ulcerans
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MUL_4107 (fadA5)
   00630 Glyoxylate and dicarboxylate metabolism
    MUL_4107 (fadA5)
   00640 Propanoate metabolism
    MUL_4107 (fadA5)
   00650 Butanoate metabolism
    MUL_4107 (fadA5)
  Lipid metabolism
   00071 Fatty acid degradation
    MUL_4107 (fadA5)
   00072 Synthesis and degradation of ketone bodies
    MUL_4107 (fadA5)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MUL_4107 (fadA5)
   00310 Lysine degradation
    MUL_4107 (fadA5)
   00380 Tryptophan metabolism
    MUL_4107 (fadA5)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MUL_4107 (fadA5)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MUL_4107 (fadA5)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MUL_4107 (fadA5)
Enzymes [BR:mul01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MUL_4107 (fadA5)
Exosome [BR:mul04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MUL_4107 (fadA5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
4579037..4580212
Genome map
AA seq 391 aa AA seqDB search
MGNPVIVEATRSPIGKRNGWLSGLHATELLGAVQKALVHKAGLSSGLQPGDVEQVIGGCV
TQFGEQSNNISRVAWLTAGLPGHVGATTVDCQCGSGQQANHLIAGLIAIGAIDIGIACGI
EAMSRVGLGANAGPDRSAIRAKSWDIDMPNQFEAAERIAKRRGITREDIDAFGLESQLRA
KRAWDEHRFDREISPIEAPVLDEQKQPTSELHMVSRDQGLRDTTMAGLSELKPVMEGGIH
TAGTSSQISDGAAAVLWMDEEKARALGLRPRARIVSQALVGAEPYYHLDGPVQSTAKVLE
KAGMKMGDIDIVEINEAFASVVLSWARVHEPEMAKVNVNGGAIALGHPVGCTGSRLITTA
LHELERTDQSTALITMCAGGALSTGTILERI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacccggtaatcgtagaggcgacgcgcagtccaatcggcaagcgcaacggatgg
ctgtcaggcctgcacgccaccgagttgttgggggcggttcagaaggcattggtgcacaag
gccgggctctcgtcgggtctacaacccggagatgtcgaacaggtcatcggcggttgcgtg
acgcagttcggggagcagtccaacaacatcagccgagtggcgtggctgaccgccggcctt
cccggtcatgtcggcgccaccactgtcgactgccagtgcggcagcggccagcaagccaac
catttgatcgccggcctgatcgcgatcggggccatcgacatcggcattgcctgcgggatc
gaggcgatgagccgggtgggcctgggcgccaacgccgggccggaccgctccgcaatccgg
gccaagtcctgggacatcgacatgccgaaccagttcgaggccgccgagcgcatcgccaag
cgccgcgggatcacccgcgaagacatcgacgcgttcggactcgaatcccagttgcgcgcc
aagcgcgcctgggacgaacaccgctttgatcgcgaaatctcaccgatcgaggccccagtg
ctcgatgagcagaagcagcccaccagcgagctgcacatggtctctcgggaccagggtctg
cgcgacaccaccatggcgggcttgagtgagctcaagccggtaatggagggcggcattcac
accgcgggcacgtcatcgcagatttctgacggcgcggccgccgtgttgtggatggacgag
gaaaaggccagggcactcggtttgcgcccacgcgcccgcatcgtcagtcaggcgctcgtg
ggcgccgagccgtactaccacctggacgggccggtgcagtcgacggcaaaggtgctcgag
aaggccgggatgaagatgggcgacatcgacatcgtggagatcaacgaggctttcgcatcg
gtggtgctgtcctgggcgcgggttcacgaacccgagatggccaaggtcaacgtcaacggc
ggcgcgatcgccctgggccacccggtgggatgcaccggcagccggttgatcaccaccgca
ctgcacgagctggaacgcaccgaccagagcaccgcgctgatcaccatgtgcgcgggcgga
gccctgtccaccggcaccattctcgagcgaatctag

DBGET integrated database retrieval system