KEGG   Mycobacterium ulcerans: MUL_4558Help
Entry
MUL_4558          CDS       T00435                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mul  Mycobacterium ulcerans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MUL_4558 (gpmA)
   01230 Biosynthesis of amino acids
    MUL_4558 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MUL_4558 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    MUL_4558 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MUL_4558 (gpmA)
Enzymes [BR:mul01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MUL_4558 (gpmA)
Exosome [BR:mul04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MUL_4558 (gpmA)
  Exosomal proteins of melanoma cells
   MUL_4558 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
5057717..5058472
Genome map
AA seq 251 aa AA seqDB search
MGDTGTLVLLRHGESDWNARNLFTGWVDVGLTEKGRAEAVRSGELLAEQDLLPDVLYTSL
LRRAITTAHLALDSADRLWIPVRRSWRLNERHYGALQGLDKAETKARYGEEQFMAWRRSY
DTPPPLIEKGSEFSQDADPRYANIDGGPLTECLADVVARFLPYFTDVIVGDLRAGKTVLI
VAHGNSLRALVKHLDQMSDEDIVGLNIPTGIPLRYDLDERLQPVVPGGTYLDPEAAAAGA
AAVASQGAAKA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgggagacaccgggacgttggtgctgcttcgccatggcgagagcgactggaacgctcgc
aacctgttcaccggctgggtcgacgtcggcctgaccgagaagggccgggccgaggcggta
cgaagcggcgaattgctggccgaacaggatctgctgcccgatgtgctctacacctcgctg
ttgcggcgcgcgatcaccactgcgcatctggcgctggacagcgccgaccggctgtggatt
ccggtgcggcgcagctggcggctcaacgaacgtcactacggggcgctgcaggggctggac
aaagccgagaccaaggcccgctacggcgaagagcagttcatggcctggcggcgcagctat
gacactccaccgccactaatcgagaagggcagtgagttcagccaggacgctgacccccgc
tacgccaacattgacggcgggccgctgaccgaatgcctggctgacgtggtggcccggttt
ctgccctacttcaccgacgtcatcgtcggtgacctgcgggccggcaagacggtgttgatc
gtcgcgcacggcaactcgctgcgcgcgttggtcaagcatctggaccagatgtccgatgag
gacatcgtcggactcaacatcccgacgggcattccgctgcgctacgacctggacgaacgg
ctgcaaccggtggtgcccgggggtacctatctggacccggaggcggccgccgcgggggct
gccgcggtggcgagtcaaggcgcggcaaaagcctga

DBGET integrated database retrieval system