KEGG   Mycobacterium ulcerans: MUL_4601Help
Entry
MUL_4601          CDS       T00435                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase HemB
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
mul  Mycobacterium ulcerans
Pathway
mul00860  Porphyrin and chlorophyll metabolism
mul01100  Metabolic pathways
mul01110  Biosynthesis of secondary metabolites
mul01120  Microbial metabolism in diverse environments
Module
mul_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MUL_4601 (hemB)
Enzymes [BR:mul01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     MUL_4601 (hemB)
Exosome [BR:mul04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MUL_4601 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD OMPdecase
Motif
Other DBs
NCBI-ProteinID: ABL06550
Pasteur: MUL_4601
UniProt: A0PW31
Position
5102414..5103397
Genome map
AA seq 327 aa AA seqDB search
MGAYPRQRPRRLRSTAAMRRLVAQTSLEPRHLVLPMFVADGIEEPRPIASMPGVMQHTRD
SLRSAAADAVSAGVGGLMLFGVPRDTSKDPVGSAGTDPDGILNAALRDLAKDLGDATVLM
AETCLDEFTDHGHCGVLDDRGRVDNDATVARYVELAVAQAQAGAHVVGPSGMMDGQVGAI
RDGLDEAGYADVVILAYAAKFASAFYGPFREAVSCSLSGDRRTYQQEPGNMREALREVEL
DLDEGADIVMIKPALGYLDVVAAAADISPVPVAAYQVSGEYAMICAAAANSRIDQRAAAL
ESLTSIRRAGADIVLTYWAADAASWLS
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcctacccgcggcagcggccgcgccggctccgctcgactgcggcgatgcgccgc
ttggtagcgcagacctcattggagccaaggcatttggtgttgccgatgttcgtcgccgac
ggtatcgaagagccgcgcccgatcgcgtcgatgccgggggtgatgcaacacacccgcgat
tcgctgcgcagcgccgccgcggacgccgtttccgccggggtgggcggcctgatgttgttc
ggggtgccccgtgacacgtcgaaggaccccgtcggctcggccggtaccgatcccgacggc
attctcaacgcggccctgcgcgacttggccaaggatctcggggacgcgacggtgctgatg
gccgaaacctgcctggacgagttcaccgaccacgggcactgcggggtgctcgatgaccgg
ggccgtgtcgacaacgacgcgaccgtggcccgctacgtcgaattggcggtcgcgcaggcg
caggccggcgcccatgtggtgggaccgagcgggatgatggacggccaggtgggtgcgatc
cgcgacgggctggacgaggccggctacgccgacgtggtgattttggcctacgcggccaag
ttcgcctcggcgttctatggccccttccgagaagcggtgagctgcagcctgtccggggat
cggcgcacctaccagcaggaaccgggcaacatgcgggaggcgctgcgcgaggtcgagctg
gatctggacgaaggtgccgacatcgtgatgatcaaacccgctttggggtatctggacgtc
gtcgccgcggccgcagacatttccccggtgccggtggccgcctatcaggtctcgggggag
tacgcgatgatttgtgcggcggcggccaacagccggatcgaccagcgggccgcggccctg
gagtcgctgaccagcatccggcgtgccggggccgatatcgtgctcacctattgggccgcc
gatgcagcgagttggctgtcgtga

DBGET integrated database retrieval system