KEGG   Mycobacterium ulcerans: MUL_4601Help
Entry
MUL_4601          CDS       T00435                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mul  Mycobacterium ulcerans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MUL_4601 (hemB)
Enzymes [BR:mul01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     MUL_4601 (hemB)
Exosome [BR:mul04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MUL_4601 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
5102414..5103397
Genome map
AA seq 327 aa AA seqDB search
MGAYPRQRPRRLRSTAAMRRLVAQTSLEPRHLVLPMFVADGIEEPRPIASMPGVMQHTRD
SLRSAAADAVSAGVGGLMLFGVPRDTSKDPVGSAGTDPDGILNAALRDLAKDLGDATVLM
AETCLDEFTDHGHCGVLDDRGRVDNDATVARYVELAVAQAQAGAHVVGPSGMMDGQVGAI
RDGLDEAGYADVVILAYAAKFASAFYGPFREAVSCSLSGDRRTYQQEPGNMREALREVEL
DLDEGADIVMIKPALGYLDVVAAAADISPVPVAAYQVSGEYAMICAAAANSRIDQRAAAL
ESLTSIRRAGADIVLTYWAADAASWLS
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcctacccgcggcagcggccgcgccggctccgctcgactgcggcgatgcgccgc
ttggtagcgcagacctcattggagccaaggcatttggtgttgccgatgttcgtcgccgac
ggtatcgaagagccgcgcccgatcgcgtcgatgccgggggtgatgcaacacacccgcgat
tcgctgcgcagcgccgccgcggacgccgtttccgccggggtgggcggcctgatgttgttc
ggggtgccccgtgacacgtcgaaggaccccgtcggctcggccggtaccgatcccgacggc
attctcaacgcggccctgcgcgacttggccaaggatctcggggacgcgacggtgctgatg
gccgaaacctgcctggacgagttcaccgaccacgggcactgcggggtgctcgatgaccgg
ggccgtgtcgacaacgacgcgaccgtggcccgctacgtcgaattggcggtcgcgcaggcg
caggccggcgcccatgtggtgggaccgagcgggatgatggacggccaggtgggtgcgatc
cgcgacgggctggacgaggccggctacgccgacgtggtgattttggcctacgcggccaag
ttcgcctcggcgttctatggccccttccgagaagcggtgagctgcagcctgtccggggat
cggcgcacctaccagcaggaaccgggcaacatgcgggaggcgctgcgcgaggtcgagctg
gatctggacgaaggtgccgacatcgtgatgatcaaacccgctttggggtatctggacgtc
gtcgccgcggccgcagacatttccccggtgccggtggccgcctatcaggtctcgggggag
tacgcgatgatttgtgcggcggcggccaacagccggatcgaccagcgggccgcggccctg
gagtcgctgaccagcatccggcgtgccggggccgatatcgtgctcacctattgggccgcc
gatgcagcgagttggctgtcgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system