KEGG   Mycobacterium ulcerans: MUL_4771Help
Entry
MUL_4771          CDS       T00435                                 

Definition
oxidoreductase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
mul  Mycobacterium ulcerans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(5287393..5288415)
Genome map
AA seq 340 aa AA seqDB search
MSVGPKLVIGANGFLGSHVTRMLIEDGAQVRVMVRPTANTRSIDDLPVTRFHGDIFDTAV
VREAMQGCDDVYYCVVDARAWLRDPAPLFHTNVEGLRNVLDVAKNAGLRRFVFTSSYATV
DRRHGHVATEEDRIGSRRVSSYVQSRVQAEDLVMDYVAQHGLPAVAMCVSTTYGSGDWGR
TPHGAFIVGAVFGKLPFLMNGIKLEVVGVDDAARAMILAAERGRSGQRYLISERMVALKE
VVRIAADEAGVAPPQRTISVPTLYALGALGSLRARLTGKDAELSLESVRMMRAEAEVDHA
KAVRELGWQPRPVEESIREAARFWASMRKNTQGARTGQPE
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtcgggcccaaactcgtcatcggcgccaatgggtttctcggctcgcacgtcacc
cgcatgctgatcgaggatggcgcgcaggtacgggtgatggtgcggcccaccgccaacacc
cgcagcatcgacgacctgccggtcacccgattccatggcgacatcttcgacacggccgtg
gtgcgcgaggcaatgcagggctgtgacgacgtctattactgcgtggtcgacgcgcgcgcc
tggttacgcgacccggcgccgctttttcacaccaacgtcgaaggcctgcgtaatgtcctc
gacgtcgccaagaacgccggcctgcgccgcttcgtgttcaccagcagctatgcgacggtg
gatcgtcggcatgggcacgtggcgaccgaggaggatcggatcgggtcacggcgggtctcg
tcctacgtccaatcccgggttcaggccgaagatctcgtcatggactacgtggcccaacat
ggactgcccgcggtggcgatgtgcgtctcgacgacctacggcagcggcgactggggtcgc
accccacacggcgccttcatcgtcggtgcggtgttcggcaagctgccgttcttgatgaac
ggcatcaagctggaagtggtgggtgtcgacgatgcggccagggcgatgatcctggccgcc
gaacgcgggcgcagcggccagcgctacctgatctccgagcggatggtcgcgttgaaagag
gtggtgcggatcgcggccgacgaggccggggtagcaccgccgcaacggacgatctcggtg
ccgacgctctatgccctgggtgcgctgggcagcttgcgggcgcggctcaccggcaaagac
gccgaactcagcctggaatcggtgcggatgatgcgcgccgaggccgaggtcgaccacgcc
aaggcggtgcgcgagttgggctggcagccgcggcccgtcgaggaatcgatacgcgaggca
gcgcggttctgggcgtcgatgcgcaagaacacccaaggcgccaggacgggacagccggag
tag

DBGET integrated database retrieval system