KEGG   Mycobacterium ulcerans: MUL_4900Help
Entry
MUL_4900          CDS       T00435                                 

Definition
(GenBank) flavoprotein
  KO
K16051  3-oxo-5alpha-steroid 4-dehydrogenase [EC:1.3.99.5]
Organism
mul  Mycobacterium ulcerans
Pathway
mul00984  Steroid degradation
mul01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    MUL_4900
Enzymes [BR:mul01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With unknown physiological acceptors
    1.3.99.5  3-oxo-5alpha-steroid 4-dehydrogenase (acceptor)
     MUL_4900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 DAO HI0933_like Pyr_redox_2 FAD_binding_3 FAD_oxidored Thi4 AlaDh_PNT_C NAD_binding_8 PNP_UDP_1 GP57 Pyr_redox_3 IlvN GIDA
Motif
Other DBs
NCBI-ProteinID: ABL06791
Pasteur: MUL_4900
UniProt: A0PWS2
Position
complement(5427022..5428635)
Genome map
AA seq 537 aa AA seqDB search
MADDTPEHIVESTDVVVIGFGATGVSAAITAREQGVQVVALDRANGGGATAISGDIIYAG
GGTAVQQQAGVRDSFEQMLTYLRLEVADAVSESTLESFVRGSPEMIDWLSNYGVPFDSTV
YPYKTSFPNNHYYLYHSGSENSGAFRSHTPPVQRGHRVKGKGNSGKQLYAPLAKAALSLG
VQFYPHTKVTKLLQDSTGRVTGVEAMTMHDAPPRIRRAYAALAAVSTKPGIYYPPLRNLM
ERRLRALERRYARAVQIRARRGVIVCAGGFIANSEWIKRYAPRYVTGLQLGTSGDDGSGI
ALAQSVGAVTERMDNVSARRLITPPSAFISTVMVDQQGQRVIDESRYGAAVGKALVHDHN
ARAWLVADADLMNEARRQMLKQPLWFQRAQAAALMVADSVRAETLADVARKAGVEPDGLQ
ATVDAHNNVIDAAATDPAGKPAEFVRRVARAPFTLLNIAVRPSLLNPTPMLTLGGIKVDE
QTGAVLDASGAAIPGLFGAGRTATGICSNSYVSGLSIADCVFSGRRAGTHAASAALE
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgacacaccggagcatattgtcgaatccaccgacgtagtcgtgatcggtttt
ggcgcgacaggtgtgtccgcggccatcacggcacgcgaacagggcgtgcaggtggtggcg
ctggatcgggctaatggtggtggcgcaaccgcgatatcgggcgacatcatctatgccggc
ggtggtacggcggttcagcagcaagccggtgtgcgcgacagcttcgaacagatgctgacc
tatctccgcctggaagtcgcagatgcagtcagcgagtcgaccctggaatcattcgtgcgc
ggtagccccgagatgatcgactggctgagcaactacggcgtgcctttcgactccaccgtt
tatccctacaaaacctcgtttccgaataatcactactacctctaccactcgggtagcgag
aattccggggcgtttcgcagccacactccgcccgtccagcgcggacaccgagtcaaggga
aaaggcaactcgggcaagcagctatatgcgccactggccaaagccgcactctcccttggt
gttcagttctacccccacaccaaggtgacaaagctgctgcaggactcgacgggtcgggtg
accggagtcgaagcgatgacgatgcacgatgcgccaccccgcattcggcgggcgtatgcc
gcgttggcggcggtgtccaccaagcccgggatctactatccgccgctgcgaaacttgatg
gagcgccgcctgcgtgcccttgagcgacgctacgcccgcgcggttcagatccgggcacgc
cgaggggtgatcgtgtgtgccggtggcttcatcgccaacagcgaatggatcaaacggtat
gccccgcgctacgtgaccgggcttcaactcggcaccagcggtgatgacggcagcggtatt
gcgctggcacagagcgtgggagcggtcaccgaacggatggacaacgtctcggcacggcgc
ctcatcacgccaccgagcgcattcatcagcaccgtcatggtcgaccagcaaggtcaacgc
gtcatcgacgagagtcggtacggcgctgcggtcggcaaagccttggtgcacgatcacaac
gccagggcatggctggtcgccgatgcggacttgatgaatgaagctcggcgccagatgctc
aagcagccgttgtggtttcagcgcgctcaagccgcggcattgatggtcgccgattcggtg
agggccgagacgctggccgacgtggcgcgcaaggcgggcgtcgaacccgacggcctgcag
gccaccgtcgacgcgcacaacaacgtaatcgacgccgcagcgacagaccccgccggtaag
cccgcggaatttgtgcgccgagtagcccgcgctcctttcaccctgctgaacatcgcggtt
cggcccagcctgctcaaccccaccccgatgctgaccctcggcgggatcaaggtcgatgaa
cagaccggagccgtgctcgacgcatccggtgcggcgattcccggtttgttcggtgcgggt
cgcacggcaaccggcatctgctccaactcctatgtcagcgggctgtccatcgcagattgc
gtgttttccgggcgtcgcgccggcacccacgccgccagcgccgcgctcgaatag

DBGET integrated database retrieval system