KEGG   Musa acuminata (wild Malaysian banana): 103968366Help
Entry
103968366         CDS       T03447                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 3-like
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mus00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    103968366
   00500 Starch and sucrose metabolism
    103968366
Enzymes [BR:mus01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     103968366
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
10
AA seq 180 aa AA seqDB search
MGMGRPSGAWSTPWLVVVLVHWLLCATERRRGAVVEASHVEFASLQSVPASVVDNRLRTG
YHFQPPRNWINDPNGPMYFNGVYHLFYQYNPNGSVWGNIVWAHSVSTDLVNWIALDPAIR
PSKPFDINGCWSGSATVLPGNRPAIFYTGIXPXXKQLXNXXXPRICPTLLPXWVNPTXTP
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggggatggggaggccgagcggagcttggtcgaccccgtggttggtggtggttcttgtg
cattggctcctctgcgccaccgagaggaggcgaggggcggtggtggaggcctcccatgtg
gagtttgcatccctccaatctgttcctgcctccgtcgtcgacaacaggctgaggactggg
tatcacttccagcccccgaggaactggatcaacgatccaaatggacccatgtacttcaat
ggcgtctaccacctcttctaccagtacaaccccaatggctccgtgtggggtaacatcgtg
tgggcccactcggtgtcgaccgacctcgtcaactggatagcactcgacccggccatccgc
cccagcaagccattcgacatcaacggatgctggtccggctccgccaccgtcctccccggc
aacaggcctgcgatcttctacaccggcatcnacccccancanaaacaactgcanaacntt
ncntncccaaggatctgtccaaccttactccccnantgggtcaaccccactncaaccccg
tga

DBGET integrated database retrieval system