KEGG   Musa acuminata (wild Malaysian banana): 103975097Help
Entry
103975097         CDS       T03447                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 3-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00052  Galactose metabolism
mus00500  Starch and sucrose metabolism
mus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mus00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    103975097
   00500 Starch and sucrose metabolism
    103975097
Enzymes [BR:mus01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     103975097
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Fur_reg_FbpA
Motif
Other DBs
NCBI-GeneID: 103975097
NCBI-ProteinID: XP_009388284
Position
Unknown
AA seq 577 aa AA seqDB search
MGSSGISLAVACVICWCFCSMEASHVVYEDLQSISPTLVNDELKPVYHFRPPRHWINDPN
GPLYYKGIYHLFYQYNPYGSVWGNIVWAHSVSADMINWKALDPAIYPSQPFDIYGCWSGS
ATILPGDKPVIVYTGIDPQKRQIQNIAFPSNLSDPYLREWTKPDHNPVIDPSDSAVNASA
FRDPTTAWYTPHDQHWSLVIGTRRGSRGVAVLYKSKDFVKWTKARHPLHSAKGTGMWECP
DVYPVALEGNQGLDTGEVGAGVKHVFKVSLDETRFDYYTLGTYYPKADKYIPDANSTDNR
NGLRYDYGNFYASKSFYDPAKKRRILWGWANESDSANADKDKGWAGVQAIPRAVWLDSNG
RQLVQWPIEELETLRHKHGSVKNRNIPSGTSFEVKNILTAQADVEVTFEVGSLENAEAFD
PLYATDAQALCAKMTAKTKGGVGPFGLLVLASADQEEATAVFFRIFKAQDKHVVLMCHDP
TRSSKREMIYKPTFAGFVDVDIEKTNKISLRSLIDHSVVESFGEGGKTCITSRVYPSIAI
GQQAHMFVFNNGAEDVKVSELNAWEMKAPEMNDDIIF
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgggatcttcaggtatatcgctggctgtggcttgtgtgatttgttggtgcttctgttcc
atggaggcatctcatgtggtgtatgaagacctgcaatccatatcacctaccttggtcaac
gatgaactgaagcccgtataccatttccgtccccctagacattggatcaacgatccaaat
gggcctctgtactacaagggcatctaccacctgttctaccagtacaacccctacggctcg
gtgtggggcaacatcgtgtgggcccactcggtctcggccgacatgatcaactggaaggcg
ctcgaccctgcgatctacccgtcccagccattcgacatctacgggtgctggtccggctcc
gcaaccatcctccccggcgacaagcccgtgatagtgtacacaggcatcgaccctcagaaa
cgacagatccaaaacatcgccttccccagcaacttatccgatccctacctgcgcgaatgg
actaagccggaccacaaccccgtgatcgacccgtcggattccgccgtcaacgcgagcgcg
ttccgtgatccgaccacggcgtggtatacgccccacgaccagcactggtctctggtgata
ggcaccaggagagggagcaggggcgtggccgtcttgtacaagagcaaggatttcgtcaag
tggaccaaggcgcgccacccgctgcactcggccaagggcaccgggatgtgggagtgcccg
gacgtgtacccggtggccttggaggggaaccaagggttggacaccggcgaagtgggtgct
ggggtcaagcacgtctttaaggttagcctggacgagacgcgattcgactactacacgttg
ggcacgtactaccctaaggcggataagtacataccggatgctaactctacggataatcgt
aatgggctgaggtatgactatggcaacttttatgcgtccaagtcgttctacgatcctgcg
aagaaacggaggattttgtgggggtgggccaatgaatcggacagtgctaatgccgacaag
gacaagggttgggcgggagttcaggcgattccaagagctgtgtggctcgatagcaacggt
aggcaactcgttcaatggccgatcgaggagttggaaacgctcagacacaagcacgggtcc
gtcaagaacagaaacatcccgagtggtacttcttttgaagtcaagaacatactgacagcg
caggctgatgtggaggtaacattcgaggttggaagcctagaaaatgccgaggcattcgat
ccactttatgccactgatgctcaagcactgtgtgccaaaatgacggcaaaaacaaagggt
ggggttggcccatttggactcctggttttggcttcagccgaccaagaagaggctactgct
gtcttcttcaggatcttcaaagctcaagacaagcacgtggtcctcatgtgccatgatcct
actaggtcatctaagagggaaatgatatacaaacctacttttgccggctttgtcgatgtc
gatatcgaaaagacaaacaagatatctcttagaagcttgattgatcactcggtggtggag
agctttggggaaggaggcaagacttgcatcacgtcaagagtttatcccagcatagcgatc
ggacaacaagctcatatgttcgtgttcaacaatggtgcagaagacgtgaaggtttcagaa
ctaaatgcatgggagatgaaagcaccagaaatgaatgacgacattatcttttga

DBGET integrated database retrieval system