KEGG   Mycobacterium vanbaalenii: Mvan_0046Help
Entry
Mvan_0046         CDS       T00449                                 

Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
mva  Mycobacterium vanbaalenii
Pathway
mva00330  Arginine and proline metabolism
mva01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mvan_0046
Enzymes [BR:mva01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Mvan_0046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: ABM10897
JGI: Mvan0046
UniProt: A1T147
Position
59149..60114
Genome map
AA seq 321 aa AA seqDB search
MQNDPRMRSESGVLGQIDAQQVPRYAGLGTFARLPQRHEVASHDIAVIGVPFDSGVTYRP
GARFGPAAIRQASRLLKPYHPALEVSPFATAQVVDAGDIAANPFDITTAVEQIKDGILGL
VTSPEQRFVLLGGDHTIALPALQAVNELHGPVALVHFDAHLDTWDTYFGAPCTHGTPFRR
ASEQGLIVKGHSAHVGIRGSLYDAADLLDDAELGFTAVHCRDIDRIGVDGVIERVLERVG
EHPVYVSIDVDVLDPAFAPGTGTPEIGGMTSRELVAVLRAMRALNIVGADVVEVAPAYDH
AEVTAVAAANLAYELISLMVG
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacgacccgcggatgcgctcggaatccggcgtgctcgggcagatcgacgcccag
caggtgccgcgctatgccgggctcggcacgttcgcgcggctgccgcaacgacacgaggtc
gcctcgcacgacatcgccgtcatcggggtcccgttcgacagcggcgtcacctaccggccc
ggggcgcgcttcggtcccgccgcgatccgtcaggcctcgcggctcctcaagccgtatcac
ccggcgctcgaggtgtcgccgttcgcgaccgcgcaggtggtcgacgccggtgacatcgcc
gccaacccgttcgacatcaccaccgcggtggagcagatcaaggacggaatcctcggcctg
gtcaccagccccgaacagcggttcgttctgctcggtggtgaccacaccattgcgctgccc
gcgctgcaggccgtcaacgagctgcacggcccggtggccttggtgcacttcgacgcccac
ctcgacacgtgggacacctatttcggggcgccgtgcacccatggcaccccgttccggcgc
gcctccgaacagggtctgatcgtcaagggccactccgcccacgtcggtatccggggctcg
ctctacgatgccgcggacctgctcgacgacgccgagttgggcttcaccgcggtgcattgc
cgcgacatcgaccgcatcggggtggacggggtcatcgagcgtgtgctcgagcgtgtcggc
gagcacccggtgtacgtgtcgatcgacgtcgacgtgctggacccggcgttcgcgccgggt
accgggacacccgagatcggtgggatgacgagtcgcgagctggtcgcggtgctgcgggcg
atgcgggcgctgaacatcgtcggcgccgacgtggtggaggtggcgccggcgtacgaccac
gccgaggtcaccgccgtggccgcggcgaacctcgcctacgagctgatcagccttatggtc
gggtga

DBGET integrated database retrieval system