KEGG   Mycobacterium vanbaalenii: Mvan_0161Help
Entry
Mvan_0161         CDS       T00449                                 

Definition
putative agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mvan_0161
Enzymes [BR:mva01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Mvan_0161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
172454..173443
Genome map
AA seq 329 aa AA seqDB search
MNEREAQRDRTSTPPPVGPVDASKTPRFAGPATFARLPRLDQVPRADVAVVGVPFDSGVS
YRPGARFGPTHVREASRLLRPYHPALDVSPFEIAQVADAGDIAVNPFNIHEAIETIEAAA
VDLTRDGTSLVTIGGDHTIALPLLRAAHATHGPVALVHFDAHLDTWDTYFGAEYTHGTPF
RRAVEEGILDTEALSHVGTRGPLYGKKDLEDDRRFGFGIVTSSDVYYQGVREIVDKLRQR
LGDRPVYLSVDIDVLDPAHAPGTGTPEAGGMTSRELLEILRGFVGLNVIGADVVEVSPAY
DHAEITGVAASHVAYDLVSLLAMRAEASR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagcgagaggcgcagcgggatcgcacatcgacaccgccccctgttggtccggtc
gacgcgtcgaagacgccgcgattcgccgggccggccacgttcgcccggctgccccggctg
gaccaggtgccccgcgccgacgtcgccgtcgtcggggtgccgttcgactccggggtgtcc
taccggcccggcgcccggttcggaccgactcacgtgcgggaggcgtcccggctgctgcgc
ccgtaccacccggcactggacgtgtcgccgttcgagatcgcccaggtcgccgacgccgga
gatatcgcggtgaacccgttcaacattcacgaggcgatcgagaccatcgaggccgccgcc
gtcgacctcacccgcgacgggacctccctcgtcacgatcggcggtgaccatacgatcgcg
ttgccgttgttgcgggctgcgcacgccacgcacggtccggtggcgctggtgcatttcgat
gcgcacctggacacctgggacacctacttcggcgccgagtacacccacggcaccccgttc
cggcgtgcggtcgaagaaggcattctcgacaccgaggcgctgtcccacgtcggcacccgc
ggcccgctgtacggcaagaaggatctggaggacgaccgccggttcgggttcggcatcgtc
acctcgtcggacgtctactaccagggcgtgcgtgagatcgtcgacaagctgcggcagcgc
ctcggggaccggcccgtgtatctgtccgtcgacatcgacgtgctcgacccggcccacgcg
ccgggcaccggcacgcccgaagcagggggaatgaccagccgcgagctgctggagatcctg
cgcggcttcgtcggtttgaacgtgatcggcgccgacgtcgtcgaggtgtcgcccgcctac
gaccacgccgagatcaccggtgtcgccgcctcgcacgtggcctacgacctggtgtcgctg
ctggcgatgagggccgaagcgtcccgatga

DBGET integrated database retrieval system