KEGG   Mycobacterium vanbaalenii: Mvan_0213Help
Entry
Mvan_0213         CDS       T00449                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Mvan_0213
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mvan_0213
Enzymes [BR:mva01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Mvan_0213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
225618..226172
Genome map
AA seq 184 aa AA seqDB search
MRIDNADLADVLVLTPTPFRDERGLFTRTFDAALFDAHLGTPGLSARFVQDSQSRSVRGV
IRGMHGRSGRGEAKLVRCAHGAIHDVLVDIRPGSVTFGRQQAFLLDDNDFRHLYVPPGFL
HGFQALTATADVCYRIDRPHDPSENLAVAHDDPDLAIDWPLAGAIVSAQDRRAPRWADLL
MQLS
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcgacaacgcggatctcgccgacgttctcgtcctcaccccgactccgttccgc
gacgagcgcgggttgttcacccggaccttcgacgccgcactcttcgacgcccatctcggg
acgcccggcctgtcggcgcgcttcgtccaggactcccagtcgcgatcggtccgcggcgta
atccgtggcatgcacggacggtccggtcggggcgaggccaagctggtccgctgtgcgcac
ggagccatccacgacgtgttggtcgacattcggccgggatcggtcacgttcggccggcag
caggctttcctgctcgacgacaacgactttcgtcatctttatgtgccgccgggtttcctg
cacggatttcaggccctcaccgctacggcggacgtctgctaccggatcgaccgtcctcat
gacccctccgagaacctggctgtcgcacacgacgatcccgacctcgcgatcgactggccg
ctggccggggcgattgtgtcggcgcaggaccgccgcgcgccgcggtgggctgatctactc
atgcagctgtcctga

DBGET integrated database retrieval system