KEGG   Mycobacterium vanbaalenii: Mvan_0256Help
Entry
Mvan_0256         CDS       T00449                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mva  Mycobacterium vanbaalenii
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mva00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:mva00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
279751..280953
Genome map
AA seq 400 aa AA seqDB search
MANPRTAPEALVGVLAASALLVGCTSSTAPEPTPHVLHATPSMAAGPALNLPAAPAPAAP
ACGDPAAIVASMSTRDKLAQRLMVGVTGAADARAVVDAHHVGGIMVGSWTDLSMLSDNSL
ADIAATAAPLPPAVSVDEEGGRVSRLAGLIGAQPSPRRLAATSSPEQVYQIALERGRKMR
GLGITIDFAPVVDVTDAPDGTVIGDRSFGADPTAVVDYAGAYARGLRDAGVLPVLKHFPG
HGSGSGDTHAGSVVTPPLGDLVARDLVPYRTLTTQGPVGVMVGHMEVPGLTGSEPASLSP
PAYALLRSGDYGGPPFGGPVFTDDLSGMQAITDRLGVADAVLRSLQAGADVALWLSTAEV
PAVLDRLEQAVAAGELTMPRIDEAVTRVIAMKGPSPRCGG
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggccaacccacggaccgcccccgaggccctcgtcggagtcctggcggcatcggcactt
ctggtcggctgcacgtcgtccactgcgccggagcccacgccacatgtgctgcacgcgacg
ccgtcgatggctgccgggcccgccctcaacctgcccgcggcccccgcgcccgccgccccg
gcgtgcggcgaccccgcagcgatcgtcgcgtcgatgtcgacccgcgacaagctcgcccag
cgcctcatggtcggggtgaccggcgccgccgacgcccgcgccgtggtcgacgcccaccac
gtcggcggcatcatggtcggcagctggaccgacctgtcgatgctgtccgacaactctttg
gccgacatcgccgccaccgccgcgccgttgccgcccgcggtcagcgtcgacgaggaaggc
ggccgggtgtcgcggctggccggactgatcggagcccagccgtcgccgcgccggctggcg
gcgaccagcagcccagagcaggtctaccagatcgcgctcgaacgcggcaggaagatgcgt
gggctcggcatcacgatcgacttcgcgcccgtcgtcgatgtcaccgacgcgccggacggc
accgtcatcggggaccggtccttcggcgccgaccccaccgcggtcgtcgactacgcgggc
gcctacgcccgcggcctccgcgacgccggtgtgcttccggtgctcaagcacttcccggga
cacggcagcggaagcggcgacacccacgccggaagcgtcgtgaccccgccgctcggcgat
cttgtggcccgcgacctggttccgtaccgcacgctgaccacgcaggggccggtcggtgtc
atggtcggccacatggaggtccccggtctgaccggcagcgaacccgccagcctcagccca
cccgcctacgcgctgctgcggtcgggcgactacggcggcccgccgttcggtgggccggtg
ttcaccgacgacctgtccggcatgcaggccatcaccgaccggctgggtgtcgccgatgcg
gtgctgcgcagcctccaggccggcgctgacgtcgcgctgtggctcagcaccgccgaggtg
cccgcggtgctggaccggttggagcaggcggtcgcggcgggggagctgacgatgccgcgt
atcgacgaggccgtgacccgggtcatcgcgatgaaaggcccgtcaccacgctgcggcggc
tga

DBGET integrated database retrieval system