KEGG   Mycobacterium vanbaalenii: Mvan_0301Help
Entry
Mvan_0301         CDS       T00449                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mva  Mycobacterium vanbaalenii
Pathway
mva00860  Porphyrin and chlorophyll metabolism
mva01100  Metabolic pathways
mva01110  Biosynthesis of secondary metabolites
mva01120  Microbial metabolism in diverse environments
Module
mva_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mvan_0301
Enzymes [BR:mva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Mvan_0301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: ABM11150
JGI: Mvan0301
UniProt: A1T1V0
Position
complement(335452..336594)
Genome map
AA seq 380 aa AA seqDB search
MSEPDWAPLTGFRVAVTSARRADELSALLRRRGATVCSAAAIEMVPLPDDDELRQHTRSL
IASPPDIVIATTGIGFRGWVAAADGWGMATELTAALSNARIVSRGPKATGALRAAGLPEE
WSPESESSRELLHYLVEGGIAGTRIAVQLHGATADWDPFPEFLDELRAAGAEVVPIRVYR
WHPAPRNGEFDQLVAGIADEKFDAVSFTSAPAVASVLLRATEMGLEAEVLSALRTNVHAM
CVGPVTARPLVRLGVPTSAPERMRLGALARHITDELPLLQTRTVRVAGHLLEIRGTCVLV
DGTVKELSPSAMATIRALALRPGAVVSRVDLLRALPGSGTDTHAVETAVLRLRTALGDKK
MVSTVVKRGYRLPVDEAFAS
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagccggactgggcgccgctcaccggattccgggttgcggtcacttccgcgcgg
cgcgctgacgagttgagtgcgctgctgcgccgccgtggcgcgaccgtctgcagcgccgcc
gccatcgagatggtgcccctacccgacgacgacgaactgcggcaacacacccggtcgctg
atcgcctccccgcctgacatcgtcatcgccaccacgggcatcgggttccgcggctgggtg
gccgccgccgacgggtggggcatggcgaccgagttgaccgccgcgctgagcaacgcccgg
atcgtgtcacgcggcccgaaggccacgggcgccctgcgcgccgccggcctgcccgaggaa
tggtcaccggagtcggaatcctcccgcgagctgctgcactacctcgtcgagggcggcatc
gccggaacccggatcgcggttcagttgcacggcgccaccgcggactgggacccattcccc
gagttcctcgacgaattacgtgccgcgggagccgaagtggtgccgatccgggtgtaccgc
tggcatccggcgccgcgcaacggcgaattcgaccagctggtggccggtatcgcggacgag
aagttcgacgcggtcagcttcacctctgcgcccgcggtcgcgtcggtgctgctgcgcgcc
accgagatgggtctcgaagcggaggtgctgtcggcgctgcgcaccaatgtccatgcgatg
tgcgtcggcccggtgacggctcggccgctggtgcgattgggcgtgcccacctcggcgccg
gaacgaatgcggttgggcgcgttggcccgtcacatcaccgacgaactgccgttgctgcag
acgcgcaccgtgcgggtggccgggcatctgctggagatccgcggcacctgcgtgctggtc
gacggcacggtcaaggagctgtccccgtcggcgatggcgacgatccgggcgttggcgctg
cggccgggcgcggtggtgtcccgcgtcgatctgctgcgcgccctgcccggtagcggcacc
gacacccacgccgtggagaccgccgtgctgcggctacgaaccgcgctgggagacaagaag
atggtgtccaccgtcgtcaagcgcggctaccggctgcccgtcgacgaggcgttcgcgtca
tga

DBGET integrated database retrieval system