KEGG   Mycobacterium vanbaalenii: Mvan_0443Help
Entry
Mvan_0443         CDS       T00449                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Mvan_0443
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mvan_0443
   00620 Pyruvate metabolism
    Mvan_0443
   00650 Butanoate metabolism
    Mvan_0443
  Lipid metabolism
   00071 Fatty acid degradation
    Mvan_0443
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mvan_0443
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mvan_0443
   00626 Naphthalene degradation
    Mvan_0443
Enzymes [BR:mva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mvan_0443
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Mvan_0443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
481487..484063
Genome map
AA seq 858 aa AA seqDB search
MSTTQMRRGEIDAVVDKAAAAAAEFRKLDQAQVDAIVEAMVRAGIRAAAALAQVAIEETG
FGVFEDKVVKNYVATEFLHDYLRDKKSVGVVEEDIENNIVRVAEPIGVVLAITPVTNPTS
TVLFKAIVAAKTRNAIVFRPSPYAVRCCERSVEILREAAEAAGMPTGALQVIPDEAHEVT
HYLFAHEKIDFLWVTGGPKIVALANAAGKPGLCVGPGNAPIYIHKTADVRGAVVDILISK
TFDSSVICPAEQTCVIDDEIYDAMIAEFERMGARLLTEEETSAIARFAFGCGDKIALEAL
GQKAPELAARAGFSVPPTVKVLLAALPADLEELAAHPLVQEKLMPVLGVVRARSVDHAID
VAVLVTEHGGLGHTSAVYANDQAVVDAYSAAVRTGRILVNAPTAVGALGGVYNNLTPTFS
LGCGTWGGSRTTENVNYRQLLNIKTVAQRRTPPQWFRVPSNTYFNAGALENLRDLDCETV
VIVTDAASDERGVVDLLRGKLRTRHVQVFSEVPPEPDESMIRRGVQLLERVQPEVLIAVG
GGSVLDAGKAMRLFFEHPEKTLDELTMPFLDPRKRVADYPTDRHRLQLVAVPTTSGTGSE
VSPAAVLTVRGRKQTLVDYSLVPDLAIVDPVLTSSMPPVLTADTGIDALTHALEAVVSIF
ASPYTDALCAQAARLIFDALPRAYRDPEDLAARTDMSNAATLAGLAFSNAFVGTNHALAH
AVGAKFGIAHGRANAIFLPHVLRYNASLPSKFMPAPGYSAYIAPDKYAQIGQLIFGGHEP
EDSRGRLFLGVQDLLEQLDMPGSLKAIGVSEDAFTAALPELAMTAFEDLSNRTNPRMPLV
SEISDLLRLGYYGSEAPG
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgacacagatgagacgcggcgagatcgacgcggtcgtggacaaggccgcggcc
gcggccgcggaattccgcaagctcgaccaggcgcaggtcgacgcgatcgtcgaggccatg
gtgcgcgccgggatccgcgcagctgccgccctggcacaggtggcgatcgaggagaccggc
ttcggggtgttcgaggacaaggtcgtcaagaactatgtggcgaccgagttcctgcacgac
tatctccgcgacaagaagtcggtcggggtggtcgaggaggacatcgagaacaacatcgtc
cgggttgccgaaccgatcggcgtcgtgctggcgatcacgccggtcaccaacccgacatcg
acggtgctgttcaaagccatcgtcgccgcgaaaacccgcaacgccatcgtgttccggccg
tcgccgtacgcggtgcggtgctgtgaacgcagcgtcgagatcctgcgcgaggcagccgaa
gcggccggcatgccgaccggggcgctgcaggtcatccccgacgaggcccacgaggtcacc
cactacctgttcgcccacgaaaagatcgacttcctctgggtgaccgggggaccgaagatc
gtcgcgctggccaatgcggccggcaaaccggggctctgcgtcggaccgggaaacgccccc
atctacattcacaagacggccgacgtccggggggccgtcgtcgacatcctcatctcgaaa
acctttgactcctcggtgatttgcccggccgagcagacgtgcgtcatcgacgacgagatc
tatgacgcgatgatcgccgagttcgaacggatgggcgcccgcctgctcacggaggaggag
acctccgcgatagcccgcttcgcgttcggctgcggcgacaagatcgccctcgaggccctg
gggcagaaggcgccggaactggccgcacgggccggcttctcggtgccgccgacggtgaag
gtgctcctggcggcgctgcccgcggacctcgaagagctcgccgcgcacccgctggtgcag
gagaagctgatgcccgtcctcggcgtggttcgggcgcgcagcgtcgaccatgccatcgac
gtcgcggtcctggtcaccgagcacggcgggttgggccacacatcggcggtgtacgccaac
gaccaggcagtggtcgacgcgtacagcgctgcggtgcgcaccggccgcatcctggtcaac
gcgcccaccgcggtcggcgctctcggcggggtctacaacaacctgaccccgaccttctcg
ctgggctgcggcacatggggtggttccagaacgaccgagaacgtcaactatcggcagctg
ctcaacatcaagaccgtcgcccagcgtcgcaccccgccgcagtggttccgggtgccgtcc
aacacgtacttcaatgccggtgcgttggagaacctccgcgacctcgactgcgagaccgtc
gtgatcgtcaccgacgcggcgagcgacgagcgtggtgtggtcgacctgttacgcgggaaa
ctgcgcacccgccatgtgcaggtgttcagcgaggtgcccccggagccggacgagtcgatg
atccgccgcggggtgcagctgctggaacgggtgcaacccgaggtgctcatcgccgttggc
ggaggttcggtgctcgacgcaggcaaggcgatgcggctgttcttcgaacacccggagaag
acgctcgacgagttgacgatgccgttcctcgacccccgtaagcgggtggccgactacccg
accgaccggcaccgtcttcaattggtcgccgtaccgacgacttcgggaaccggttcggag
gtgtcacccgcggcggtgttgacggtgcgcggcaggaagcagacgttggtcgactacagc
ctggtgcccgacctcgcgatcgtcgacccggtgctgacgtcgtcgatgccaccggtgctg
accgcggacaccggcatcgacgcgctgacacatgcactggaggcggtcgtctccatcttc
gcctccccctacaccgatgcgttgtgtgcgcaggcggcgcgactgatcttcgacgccctg
ccgagggcgtaccgcgacccggaggatctggccgcgcggaccgacatgtcgaacgcggcg
acgctggccggcctcgccttctcgaatgccttcgtcggaaccaaccatgccctcgcccat
gccgtcggcgcgaagttcggtatcgcccacggacgggcgaacgcgatatttctgccgcat
gtgttgcgctacaacgcaagtctgccgagcaagttcatgcctgcacccgggtattcggcc
tacatcgcacccgacaagtacgcccagatcggccagctcatcttcggtggccacgaaccg
gaagacagtcgcggccgtctgttcctgggcgtgcaggacctgctcgaacaactcgacatg
cccggttcactcaaggcgatcggggtatcggaggacgcgttcaccgcggcgctgccggaa
ctggcgatgaccgccttcgaagacctcagtaaccggaccaacccgagaatgcctctcgtc
agcgagatctcggacctgctgcggctgggctactacggatccgaagcgccggggtga

DBGET integrated database retrieval system