KEGG   Mycobacterium vanbaalenii: Mvan_0451Help
Entry
Mvan_0451         CDS       T00449                                 

Definition
class II aldolase/adducin domain-containing protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Mvan_0451
Enzymes [BR:mva01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Mvan_0451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
492162..492947
Genome map
AA seq 261 aa AA seqDB search
MTSTMHDSKSDLMRRALDGLSRNVTESSLTLREKLAVTCRALFDAGHDSGLAGQITARAE
APGTYYTQRLGLGFDEITAGNLLLVDEDLKVLDGEGMANPANRFHSWIYRARPDVNCIVH
THPFHVAALSMLEVPLVVSQMDIAPLYGDCAFLPDWPGVPVGNEEGEIISAALGDKKAIL
LAHHGHVVAGASVEEACSLAMLVERGAKLQLAAMAAGTIAPLPDRLAREAHDWTLTPKRS
QANFAYYARRALANHPDALDR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcaccatgcacgattcgaagagcgatctgatgcggcgtgccctcgacggattg
agccgcaacgtcaccgaatccagcttgacgctgagggagaagctggcggtgacctgtcgc
gcgctgttcgacgccggacatgactccggcctcgccggccagatcaccgcccgcgcggag
gcccccggtacgtactacacccagcgcctcggcctcggcttcgacgagatcaccgccggc
aatctactgctcgtcgacgaagacctcaaagtcctcgacggtgaaggaatggccaacccc
gccaaccgtttccactcgtggatctaccgggcccgccccgacgtcaactgcatcgttcac
acgcaccccttccatgtggcggccctgtccatgctcgaagttccgctcgtcgtctcccag
atggacatcgcgccgctgtacggcgactgcgcgttccttcccgactggccgggtgtgccg
gtgggcaacgaagagggcgagatcatctccgcggccctcggcgacaagaaggcgatcctg
ttggcccaccacggacacgtcgtcgccggtgccagcgtcgaggaggcctgctcgctggcg
atgctcgtcgagcgcggcgccaagctgcaactggccgccatggccgcgggcaccatcgcg
ccgctgcccgaccgactggcccgcgaggcccacgactggacgctgacgcccaagcgcagc
caggcgaacttcgcctactacgcccggcgcgccctcgccaaccatcccgacgccctcgac
cgctga

DBGET integrated database retrieval system