KEGG   Mycobacterium vanbaalenii: Mvan_0596Help
Entry
Mvan_0596         CDS       T00449                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mva  Mycobacterium vanbaalenii
Pathway
mva00360  Phenylalanine metabolism
mva00362  Benzoate degradation
mva00620  Pyruvate metabolism
mva00621  Dioxin degradation
mva00622  Xylene degradation
mva00650  Butanoate metabolism
mva01100  Metabolic pathways
mva01120  Microbial metabolism in diverse environments
mva01220  Degradation of aromatic compounds
Module
mva_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mvan_0596
   00650 Butanoate metabolism
    Mvan_0596
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Mvan_0596
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mvan_0596
   00622 Xylene degradation
    Mvan_0596
   00621 Dioxin degradation
    Mvan_0596
Enzymes [BR:mva01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Mvan_0596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ABM11435
JGI: Mvan0596
UniProt: A1T2N5
Position
637871..638818
Genome map
AA seq 315 aa AA seqDB search
MTPTVKCPVAILGSGDVGTDLMMKILRSDGPLTVGALVGLDPEPGGLARAERLGVPTSAA
GIDGLPAMPEFGDIGIVFDATPAGAPRAELEKAGVCVLDLNPAVVGPHCVPAVNLEDHLD
TPNLNLVTGAGQATVPIVAAVGRVGAVSYAETVTSVAAKSADPATRANIDESIETTTAAL
RTVGGARRARSIFIINPADPPILMRNTVYCLVDGDVPRGDIEQSIAAMVERVTSYVPGYR
LKQRVQFETFTATDPLHIPETGGFTGTRVTVLVEVTAGEPHLPGYAGNLEMMTSAAKAAA
ERIALHRSRTAGAAT
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgacagtcaagtgcccggtggcgatcctcggctccggggacgtcggcaccgac
ctgatgatgaagatcctgcgcagcgacggaccgctgacagtcggcgcgcttgtgggcctc
gacccggaacccggcgggctggcccgcgcggaacgccttggcgttccgacttccgcggcg
gggatcgacggtctgccggcgatgccggaattcggcgacatcgggatcgtcttcgacgcc
accccggcgggtgcacccagggccgaactcgaaaaggcgggggtgtgcgtcctcgatctg
aacccggcggtcgtcggacctcactgcgtgcctgcggtcaaccttgaggaccacctcgac
acgccgaacctgaacctggtcaccggagccggacaggcgacggtgcccatcgtggccgcc
gtcggccgggtgggcgccgtgtcctatgccgagaccgtcacgtctgttgcagcgaagtcc
gcagacccggcgacccgtgccaacatcgacgagtcgatcgaaaccaccacagccgcgctg
cgcacagtcgggggagctcggcgtgcgcgctcgatcttcatcatcaaccccgccgacccg
ccgatcctgatgcgcaacacggtctactgcctcgtcgacggcgacgtccctcgcggggac
atcgagcagtcgatcgccgccatggtggaaagagtcacttcctatgtgcccggttaccgg
ctcaagcagcgggtgcagttcgagaccttcaccgcgaccgatccgttgcacatccccgag
accggcggcttcaccggcacccgcgtcaccgtgctggtggaggtcacggccggcgagccc
cacctccccggctacgcgggcaacctcgagatgatgacctctgcggccaaggcggccgcc
gaacgcatcgcgctgcaccgcagccggaccgcaggtgcggcaacatga

DBGET integrated database retrieval system