KEGG   Mycobacterium vanbaalenii: Mvan_0829Help
Entry
Mvan_0829         CDS       T00449                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mvan_0829
   01230 Biosynthesis of amino acids
    Mvan_0829
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mvan_0829
  Energy metabolism
   00680 Methane metabolism
    Mvan_0829
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mvan_0829
Enzymes [BR:mva01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mvan_0829
Exosome [BR:mva04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mvan_0829
  Exosomal proteins of melanoma cells
   Mvan_0829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
864852..865604
Genome map
AA seq 250 aa AA seqDB search
MAETATLILLRHGESEWNALNLFTGWVDVDLTEKGRAEAARAGELLKAQDRLPDVLYTSL
LRRAITTANIALDKADRHWIPVHRDWRLNERHYGALQGLDKAETKAKYGEEQFMAWRRSY
DTPPPPIEAGSEFSQDRDPRYADVVGGAPLTECLKDVVERFVPYFTEVIVPDLKAGKTVL
IAAHGNSLRALVKYLDGMSDEDVVGLNIPTGIPLRYDLDADLKPTVPGGSYLDPEAAAAG
AAAVAAQGAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaccgcgacgctgatcctgctccgccacggtgagagcgaatggaatgcgctg
aacctgttcaccggctgggtcgacgtggacctcaccgagaagggcagggccgaagcggcg
cgcgcaggcgagcttctcaaggcgcaggaccggctgcccgacgtgctgtacacctcgctg
ctgcggcgcgcgatcaccaccgccaatatcgcgctggacaaggccgaccggcactggatc
ccggtacaccgggactggcgcctcaacgagcgtcactacggcgcgttgcagggtctcgac
aaggccgagacgaaggccaagtacggcgaggaacagttcatggcgtggcgccgcagctac
gacaccccgccgccaccgatcgaggccggcagcgagttcagccaggaccgtgacccgcgt
tatgccgacgtcgtcggcggcgccccgctgacggagtgcctcaaggacgtcgtcgaacgt
ttcgtgccgtacttcaccgaggtgatcgttccggacctgaaagccggtaagaccgtgctg
atcgcggcacacggcaattcgctgcgggcgctggtgaagtatctggacggcatgtccgat
gaggacgtcgtcggcctgaacatccccaccggaatcccgctccggtacgacctcgatgcc
gacctcaagcccaccgtgcccggcggcagctacctcgacccggaggctgccgccgcggga
gcggcggcggtggccgcgcagggagccaaatag

DBGET integrated database retrieval system