KEGG   Mycobacterium vanbaalenii: Mvan_0846Help
Entry
Mvan_0846         CDS       T00449                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mva00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
880655..882370
Genome map
AA seq 571 aa AA seqDB search
MSLRGRKGKPGRITFVGSGPGDPGLLTTRARAVLAHAALVFTDPDVPEAVLELVGSELPP
PSGPLPPVAAGAAPKPADAVVKQDADAAEKPAEGSKAAEDAVIPGGPDVRPALGDPVEVA
KTLATEARTGVDVVRLVAGDPLSIDSVITEINALAKTQLNFEIVPGLPGTSAVPTYAGLP
LGSSHTVADVRDPNVDWAALAAAPGPLILHATASHLPEAARTLIEYGLADSTPAVVTANG
TTCQQRSIETTLGGLLDKAVLDKPAVAEPAGPLTGTLVVTLGRTVAHRAKLNWWESRALY
GWTVLVPRTKDQAGEMSDRLVGHGALPIEVPTIAVEPPRSPAQMERAVKGLVDGRFQWVV
FTSTNAVRAVWEKFNEFGLDARAFSGVKIACVGQATAERVRAFGINPELVPTGEQSSLGL
LDEFPPYDDIFDPVNRVLLPRADIATETLAEGLRERGWEIEDVTAYRTVRAAPPPAQTRE
MIKTGGFDAVCFTSSSTVRNLVGIAGKPHARTIVACIGPKTAETAAEFGLRVDVQPEVAA
VGPLVEALAEHAARLRAEGALPPPRKKSRRR
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgagcttgcgaggacgcaagggcaagcccggccgcatcacgttcgtcggctccgggccc
ggggatccgggtctgctgacgacgcgggcgcgggcggtgttggcccacgccgccctggtg
ttcaccgatcccgacgtgcctgaagcggtgctggagctggtgggttccgagctaccgccg
ccgtcggggccgctgccgcctgtcgccgccggcgcggctccgaaacccgccgatgcggtg
gtgaaacaggacgccgacgcggcggagaagccggccgagggcagcaaggctgccgaagac
gcggtcatccccgggggacccgacgtgcgtcccgccctgggcgatccggtcgaggtcgcc
aagacgctggccaccgaggcccgcaccggggtcgacgtggtccggctcgtcgcaggagat
ccgctgtcgatcgactcggtgatcaccgagatcaacgcactggccaagacccagctgaac
ttcgagatcgtgccgggactgcccggtacctcggcggtgcccacctacgcgggtctgccg
ctgggctcgtcgcacaccgtcgcggacgtgcgcgatcccaatgtcgactgggcggcgctg
gccgccgcaccgggaccgctgatcctgcacgccacggcatcgcacctgccggaggcggca
cgcacgctgatcgagtacggcctcgccgattccaccccggccgtggtcacggccaacggc
accacctgtcagcagcgttcgatcgagacgacccttggtgggctgctcgacaaggcggtg
ctggacaagccggctgtcgccgaacccgcaggcccgctgaccggcacgctggtggtcacc
ctcggtcgcaccgtcgcccaccgcgcgaagctgaactggtgggagagcagggcactgtac
gggtggaccgttctggtgccgcgcaccaaggatcaggcgggtgagatgagcgaccgcctt
gtcggacacggcgcgctgcccatcgaggtgccgaccatcgcggtcgagccgccgcgcagc
ccggcccagatggaaagggccgtcaagggattggtggacggccggttccagtgggtggtg
ttcacctccaccaatgccgtgcgtgcggtgtgggagaagttcaacgaattcggtctggac
gcgcgcgcattctccggcgtgaagatcgcctgcgtcggtcaggcgacggcggaacgggtt
cgcgccttcgggatcaaccccgagctggtacccacgggtgaacagtcgtctctgggcctg
ctcgacgagttcccgccgtatgacgacattttcgatccggtgaaccgggtgctgttgccg
cgcgcggacatcgccaccgaaacgctggccgaaggtctgcgcgagcgcggctgggagatc
gaggacgtcaccgcctaccgcacggtgcgcgcggcaccgccgccggcgcagacccgcgag
atgatcaagaccggtggcttcgacgccgtgtgcttcacgtcgagttcgacggtgcgcaac
ttggtcggcatcgcgggtaagccgcacgcccgcaccatcgtggcctgcatcggacccaaa
accgccgagaccgcagcggagttcgggctgcgcgtggacgtgcagccggaggtcgccgcg
gtgggaccgctggtggaggcgctggccgagcacgccgccaggctgcgggccgagggtgca
ttgccgccaccgcggaagaagagccgccgccgctaa

DBGET integrated database retrieval system