KEGG   Mycobacterium vanbaalenii: Mvan_0847Help
Entry
Mvan_0847         CDS       T00449                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mvan_0847
Enzymes [BR:mva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Mvan_0847
Exosome [BR:mva04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mvan_0847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
882448..883428
Genome map
AA seq 326 aa AA seqDB search
MAFPRHRPRRLRTTPAMRRLVAQTSLEPRHLVLPMFVADGIEEPRDITSMPGVVQHTRDS
LRRAAADAVAAGVGGLMLFGVPRDEDKDPTGSVGVDPDGILNRALRDLAKDLGDSTVLMA
DTCLDEFTDHGHCGVLDPTGRVDNDLTNRRYVELAVAQANSGAHMVGPSGMMDGQVAAIR
DGLDAAGYSETAILAYAAKFASGFYGPFREAVGSSLQGDRRTYQQDPGNAREALHEIQLD
IDEGADIVMVKPAMAYLDVVRAAAEISPVPVAAYQVSGEYSMIAAAGEKGWIDLPAVVLE
SLEGIRRAGADIALSYWAVDVAHWLS
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggcctttcctcgtcaccggcccaggaggctgcggaccaccccggcgatgcgtcggctg
gtcgcccagacatcgctggagccaaggcatctggtattgccgatgttcgtcgccgacggc
atcgaggaaccgcgggacatcacgtcgatgcccggggtggtgcagcacacccgcgattcg
ttgcgccgggctgccgccgatgcggtcgcggcgggcgtcggcgggttgatgctgttcggt
gtccccagggatgaggacaaggatcccaccggcagcgtcggtgtcgaccccgacggcatc
ctcaatcgggcgcttcgggatctggccaaggatctcggcgacagcacggtgctgatggcc
gacacctgcctcgatgagttcaccgaccacggccactgcggggtgctcgaccccaccggc
cgggtcgacaatgacctcaccaatcgacgctacgtcgaactagcggtagcccaagcgaat
tcgggtgcccacatggtcggtcccagcggcatgatggacggtcaggtcgccgcgatccgc
gacggcctcgacgctgccgggtacagcgagaccgcgatcctggcctacgccgcgaagttc
gcgtcgggcttctacggacccttccgggaggcggtcgggtccagcctgcagggcgatcgg
cgcacctatcagcaggatcccggcaacgcgcgcgaggcgctgcacgagatccaactggac
atcgacgagggcgccgacatcgtgatggtcaaaccggcaatggcctacctcgacgtggta
cgggccgccgctgagatctcgccggttccggtggccgcctatcaggtgtcgggcgagtac
tcgatgatcgccgcggcaggcgagaagggctggatcgacctgcccgccgtggtgctggag
tccttggagggaatccggcgtgccggtgccgacatcgcgctgtcctactgggccgtcgac
gtggcccactggctgtcgtga

DBGET integrated database retrieval system