KEGG   Mycobacterium vanbaalenii: Mvan_0903Help
Entry
Mvan_0903         CDS       T00449                                 

Definition
(GenBank) Limonene-1,2-epoxide hydrolase
  KO
K10533  limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
mva  Mycobacterium vanbaalenii
Pathway
mva00903  Limonene and pinene degradation
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mvan_0903
Enzymes [BR:mva01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     Mvan_0903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LEH SnoaL_2 SnoaL
Motif
Other DBs
NCBI-ProteinID: ABM11741
JGI: Mvan0903
UniProt: A1T3J1
Position
930168..930596
Genome map
AA seq 142 aa AA seqDB search
MSNEAVVRAFLKGMEQPISKVPEHLRESMTHDAVWGNSGFPPCVGIEDIMSKHEMSAEVF
GDYVLTAEILNLAEGPDGVVFTERIDVGRTGAGEHILTVPVVGVFEVRDGKVSRWTDYFD
PRGLLENLAKLPDVEAFFTGKK
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgaggccgtcgtccgcgcgttcctcaagggtatggagcagccgatctcgaag
gtgcccgagcatctccgggagtcgatgactcacgatgccgtgtggggaaactcgggcttc
ccgccctgcgtggggatcgaggacatcatgtccaagcacgagatgagcgccgaagtgttc
ggagactatgtgctgaccgcagagattctcaacctcgccgagggacctgacggagtggtg
ttcaccgagcgcatcgatgtcggacgtacaggggccggcgagcacatcctgaccgtgccc
gtggtgggcgtcttcgaggttcgcgacggcaaggtctcacggtggacggactacttcgat
ccgcgtggccttttggagaatctcgcgaagttgccggatgtcgaggcgttcttcactggc
aaaaagtag

DBGET integrated database retrieval system