KEGG   Mycobacterium vanbaalenii: Mvan_0903Help
Entry
Mvan_0903         CDS       T00449                                 

Definition
limonene-1,2-epoxide hydrolase
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mvan_0903
Enzymes [BR:mva01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     Mvan_0903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
930168..930596
Genome map
AA seq 142 aa AA seqDB search
MSNEAVVRAFLKGMEQPISKVPEHLRESMTHDAVWGNSGFPPCVGIEDIMSKHEMSAEVF
GDYVLTAEILNLAEGPDGVVFTERIDVGRTGAGEHILTVPVVGVFEVRDGKVSRWTDYFD
PRGLLENLAKLPDVEAFFTGKK
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgaggccgtcgtccgcgcgttcctcaagggtatggagcagccgatctcgaag
gtgcccgagcatctccgggagtcgatgactcacgatgccgtgtggggaaactcgggcttc
ccgccctgcgtggggatcgaggacatcatgtccaagcacgagatgagcgccgaagtgttc
ggagactatgtgctgaccgcagagattctcaacctcgccgagggacctgacggagtggtg
ttcaccgagcgcatcgatgtcggacgtacaggggccggcgagcacatcctgaccgtgccc
gtggtgggcgtcttcgaggttcgcgacggcaaggtctcacggtggacggactacttcgat
ccgcgtggccttttggagaatctcgcgaagttgccggatgtcgaggcgttcttcactggc
aaaaagtag

DBGET integrated database retrieval system