KEGG   Mycobacterium vanbaalenii: Mvan_1026Help
Entry
Mvan_1026         CDS       T00449                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mvan_1026
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Mvan_1026
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mvan_1026
Enzymes [BR:mva01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Mvan_1026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1077123..1078658
Genome map
AA seq 511 aa AA seqDB search
MSPKLSRRAALKGAVGLAAVPLLGFTGEPRRGVVAADPFTLGVASGEPSPDGVVIWTRLA
PRPLADDGLGGMPARVVDVEWEVAGDETFTRIEQRGRSVATPESAHSVHVEVAGLRPGGE
YFYRFRAEGYLSPAGRTRTAPATDAPASSLTMCFASCSNFEQGWFTAYRRLAEEEPDLVL
HLGDYQYEYAAREHAVRRHVGPETVTLANYRQRYAQYKTDPDLQAAHAAAPWLVVWDDHE
LDNNWADEVPEEPQPDYSARRAAALQAYYENMPLRSSAMPRGGEMRLFRRVEWGALATFH
MLDTRQYRSDQACDDQYRSDCPARLDPFRTLTGQAQEQWLLNGFQQSRARWDLLGQQVFF
SQLDLTPGPGRGFNPDAWDGYVANRDRITTGIANSPVRNAVLLTGDVHAHWAAEVYERAG
DPLSRRVATELVTTSISSGGDGSDTRADVDEILPDNPHIRYFSNRRGYVRTRITPDELRA
DFRTVPYVTSPGAPVQVGASFRIPDRLPQLL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgccgaagctcagccgccgcgccgccctcaagggtgcggtcggcctcgccgccgtc
ccgctgctcgggttcaccggcgaacctcgacgtggcgtcgtcgcggccgatccgttcacc
ctcggggtggcctcgggggagccgagccccgacggggtggtgatctggacccggttggcg
ccccggccgctggccgatgacggactgggcggcatgccggcgcgcgtcgtggatgtggaa
tgggaggtcgccggtgacgagaccttcacccggatcgagcagcggggccgctccgtcgcg
acgcccgagtcggcgcacagcgtgcacgtcgaagtcgccgggttgcggcccggcggcgag
tacttctaccggttccgggccgagggttacctctcgcccgcgggccggaccaggaccgcg
ccggcaaccgacgcgccggcgtcgtcgctgacgatgtgcttcgcgtcctgctcgaacttc
gagcagggctggttcaccgcgtaccggcggctggccgaagaggagccggatctcgttctg
cacctgggtgattaccaatacgagtacgccgcgcgcgaacatgctgtccgtcggcacgtc
ggccctgagaccgtcacactggcgaactaccgtcagcgctatgcgcagtacaagacggac
cccgatctccaggctgcgcacgccgccgccccctggctggtggtgtgggacgaccatgag
ctggacaacaactgggccgacgaagttcccgaggagccgcaaccggactactcagcgcgg
cgcgccgccgcgctgcaggcgtactacgagaacatgccgctgcgctcgtcggcgatgccc
cgcggcggcgagatgcgactcttccggcgggtggagtggggtgcgctcgcgaccttccac
atgctcgacacccgccagtaccggtccgaccaggcatgcgacgaccagtaccgcagcgac
tgcccggcgcgtctggaccccttccgcacgctgaccggtcaggcgcaggaacagtggctg
ctcaacgggtttcagcagtcgcgggcgcggtgggatctgctcggtcagcaggtgttcttc
agccagctggacctgacaccgggaccgggccgcggattcaaccccgacgcgtgggacggc
tacgtcgccaaccgggaccggatcacgacggggatcgcgaactccccggtgcgcaacgca
gtgctgttgaccggtgatgtgcacgcgcattgggcggccgaggtgtacgagcgcgccggt
gacccgctgtctcgcagggttgcaacggaattggtcaccacatcgatctcgtcgggcggc
gacggttccgacacccgcgccgatgtcgatgagattctgccggacaacccccacatccgg
tacttcagcaatcgccgcggctacgtccgcacccgcatcacgcccgacgagttgcgtgcc
gacttccgtaccgtgccgtatgtgacgagcccgggcgcaccggtccaggtgggcgcgtcg
ttccgtatccccgaccgcctcccgcaactcctctag

DBGET integrated database retrieval system