KEGG   Mycobacterium vanbaalenii: Mvan_1251Help
Entry
Mvan_1251         CDS       T00449                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mva  Mycobacterium vanbaalenii
Pathway
mva00010  Glycolysis / Gluconeogenesis
mva00052  Galactose metabolism
mva00500  Starch and sucrose metabolism
mva00520  Amino sugar and nucleotide sugar metabolism
mva00521  Streptomycin biosynthesis
mva01100  Metabolic pathways
mva01110  Biosynthesis of secondary metabolites
mva01120  Microbial metabolism in diverse environments
mva01130  Biosynthesis of antibiotics
mva01200  Carbon metabolism
Module
mva_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mva_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mvan_1251
   00052 Galactose metabolism
    Mvan_1251
   00500 Starch and sucrose metabolism
    Mvan_1251
   00520 Amino sugar and nucleotide sugar metabolism
    Mvan_1251
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mvan_1251
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Mvan_1251
Enzymes [BR:mva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mvan_1251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase FGGY_N
Motif
Other DBs
NCBI-ProteinID: ABM12086
JGI: Mvan1251
UniProt: A1T4I6
Position
1336708..1337628
Genome map
AA seq 306 aa AA seqDB search
MNDLVLALDIGGTKIAAGLVDADGTLVHRAQQPTPDGDAETVWDTAAALLAETRDAAPGP
VSAVGIGSAGPIDVPGGTVSPINIAEWSHFPIVRRVADLTGLPVRLGGDGLCMALGEWWR
GAGRGAGFLLGMVVSTGIGGGLVLDGAPYHGRSGNAGHVGHVVVEPGGAPCTCGGRGCVE
TVASGPHLARWAHDNGWAAAPDADAKDLAEAAGRGDPVALRAFARGADAVARTIASVAAV
CDLDLVVVGGGVAKAGALLFDPLRQALTMYAGLEFLRGLRVVPAELGGDAGLVGAAALVH
DSVRFG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacctcgtcctggcgctcgacatcggtggcaccaagatcgccgccgggctcgtc
gacgccgacggcaccctcgtccaccgggctcagcaacccacccccgacggcgacgccgag
accgtctgggacaccgccgcggcgctgctggccgagacgcgcgacgcggctccgggcccg
gtttcggcggtcgggatcgggtccgccggccccatcgacgtccccggcggcaccgtcagc
cccatcaacatcgccgagtggagccacttcccgatcgtgcgacgcgtcgccgacctgacc
gggttgccggtacggctcggtggcgacggtctgtgcatggcgctgggcgagtggtggcgc
ggcgccggccgtggcgccgggttcctgctgggaatggtggtgtccaccggtatcggcggc
ggactggtgctcgacggcgcgccgtatcacggccgcagcggcaacgccggtcacgtcggg
catgtcgtcgtcgaacccggcggcgcgccgtgcacgtgcggcggccgcggctgtgtcgag
accgtcgcgtcgggtccgcacctggcgcggtgggcccacgacaacggctgggccgcagca
cccgacgccgatgcgaaggacctcgccgaggcggccggccgcggtgacccggtggcgctg
cgtgcgttcgctcgtggcgcggacgccgtcgcgcggacgatcgcgtcggtggccgcggtg
tgcgacctcgacctcgtcgtcgtcggcggtggtgtcgcgaaggcgggcgcgctgctgttc
gatccgttgcggcaggcactgaccatgtacgcggggctggaattcctgcgggggctgcgg
gtggtgcccgccgaactcggcggtgacgccggtctggtgggtgcagccgccctggtccac
gacagtgtgcgttttggctga

DBGET integrated database retrieval system