KEGG   Mycobacterium vanbaalenii: Mvan_1270Help
Entry
Mvan_1270         CDS       T00449                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mva  Mycobacterium vanbaalenii
Pathway
mva00071  Fatty acid degradation
mva00280  Valine, leucine and isoleucine degradation
mva00281  Geraniol degradation
mva00310  Lysine degradation
mva00360  Phenylalanine metabolism
mva00362  Benzoate degradation
mva00380  Tryptophan metabolism
mva00410  beta-Alanine metabolism
mva00627  Aminobenzoate degradation
mva00640  Propanoate metabolism
mva00650  Butanoate metabolism
mva00903  Limonene and pinene degradation
mva00930  Caprolactam degradation
mva01100  Metabolic pathways
mva01110  Biosynthesis of secondary metabolites
mva01120  Microbial metabolism in diverse environments
mva01130  Biosynthesis of antibiotics
mva01212  Fatty acid metabolism
Module
mva_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mvan_1270
   00650 Butanoate metabolism
    Mvan_1270
  Lipid metabolism
   00071 Fatty acid degradation
    Mvan_1270
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mvan_1270
   00310 Lysine degradation
    Mvan_1270
   00360 Phenylalanine metabolism
    Mvan_1270
   00380 Tryptophan metabolism
    Mvan_1270
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mvan_1270
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mvan_1270
   00281 Geraniol degradation
    Mvan_1270
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mvan_1270
   00627 Aminobenzoate degradation
    Mvan_1270
   00930 Caprolactam degradation
    Mvan_1270
Enzymes [BR:mva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mvan_1270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 SDH_sah ACP_syn_III_C DUF3756
Motif
Other DBs
NCBI-ProteinID: ABM12104
JGI: Mvan1270
UniProt: A1T4K4
Position
1365777..1366685
Genome map
AA seq 302 aa AA seqDB search
MTETLKTMTYEVTGRVARITFNRPETGNAIIADTPLELAALVERADLDPSVHVILVSGRG
EGFCAGFDLGAYAEGSSTAGTDRRGTVLDGKTQAINHRADQPWDPMIDYQMMSRFVRGFS
SLMRCDKPTVVKIHGYCVAGGTDIALHADQVIAAADAKIGYPPTRVWGVPAAGMWAHRLG
DQRAKRLLLTGDCLTGAQAAEWGLAVEAPDPADLDERTERLVERIAAVPVNQLIMVKLAM
NSALYNQGVATSAMISTVFDGIARHTPEGHAFVAQAREHGFREAVRGRDEPFGDYGRTTS
GV
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagaccctcaagacgatgacctacgaggtcaccggccgggtcgcccgcatcacg
ttcaaccgccccgagacgggcaacgcgatcatcgccgacaccccgctggagctcgcggcg
ctcgtcgaacgcgccgacctggacccgagcgtccacgtgatcctggtgtccgggcgcggc
gaaggcttctgcgccgggttcgacctgggggcctacgccgaagggtcctcgacggcgggc
accgaccggcggggcaccgtgctcgacggcaagacccaggcgatcaaccaccgcgccgat
cagccctgggatccgatgatcgactaccagatgatgagccggttcgtgcgcggcttctcc
agcctgatgcgctgcgacaagccgaccgtcgtcaagatccacggctactgcgtggcgggc
ggcaccgacatcgcgctgcacgccgaccaggtgatcgccgcggcggacgccaagatcggc
tacccgcccacccgggtgtggggtgtgcccgccgcgggcatgtgggcgcaccgactcggc
gatcagcgggccaaacgccttctgctgaccggggattgcctgaccggcgcgcaggccgcc
gagtgggggctcgcggtggaggcgcccgatccggccgacctcgacgagcgcaccgagcgg
ctggtcgaacggatcgccgccgtcccggtcaaccagctgatcatggtcaagctcgcgatg
aacagcgcgctgtacaaccagggggtggccaccagcgcgatgatctccaccgtgttcgac
ggcatcgcccgccacaccccggaagggcatgcgttcgtcgcccaggcccgtgagcacggc
ttccgcgaggcggtgcgcggccgcgacgaacccttcggggactacggccgaacgacgtcc
ggggtgtag

DBGET integrated database retrieval system