KEGG   Mycobacterium vanbaalenii: Mvan_1394Help
Entry
Mvan_1394         CDS       T00449                                 

Definition
ribokinase-like domain-containing protein
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:mva01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mva01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mva00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:mva00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mva00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mva00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:mva00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1485463..1486407
Genome map
AA seq 314 aa AA seqDB search
MTPLSIVTLTMNTALDVAADADEVVPTEKVRCRAVRYDAGGGGVNVARFARVLGATVSAV
FTAGGSTGSRVIDMVEAAGVPGVPVPIEGATRESFTVNERATGKQYRFVLPGPVLSPGEE
ARCLEALRQAAYSAQFVVASGSLPPGVPLDFYQRVADMCREAGALLILDTSGGGLSHITS
GVYLLKPSVRELRECVGRPLPTEAEQLAAAHELIDRGIARIVVVSLGAQGALLAASSHSE
RFPALPVAAVSGIGAGDAMVAGITVGLAEGWTLDRAVRYGIAAATAKLQTPATSVFDRAD
VEHHFAEQLAPSGT
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgactcctctgtcgatcgtcacgctgacgatgaacaccgcactcgacgtcgccgccgac
gccgacgaagtcgttcccaccgagaaggtccgctgccgcgcggtgagatacgacgcaggc
ggcggcggcgtcaacgtggcgcggttcgcccgggtgctgggagcgacggtgtcggcggtg
ttcaccgcgggcgggtcgaccggctcacgggtgatcgacatggtcgaggcagcgggagtg
cccggtgtccccgttcccatcgaaggggcgacccgcgagagcttcaccgtcaacgagcgt
gccaccggaaagcagtaccggttcgtgctgcccggccccgtcctgagtcccggtgaagag
gcgcgctgtctcgaagcgctgcggcaggccgcgtactcggcgcagttcgtggtggccagc
ggcagcctgccgccgggggtgccgctcgatttctaccagcgggtggccgacatgtgccgg
gaggcgggcgcgctgctgatcctggacacctcgggaggcgggctgagccacatcacgtcc
ggtgtctacctgctcaagccgagcgtccgtgagctgcgcgagtgcgtcggacgcccgctg
ccgacggaggcagagcagctggcggcggcgcacgagctcatcgaccgggggatcgcccgg
atcgtcgtcgtgtcgctgggtgcgcagggcgcgctgctggcggcgtcatcgcacagcgaa
cggtttccggcgctgcccgtcgccgcggtcagtggcatcggcgccggagacgcgatggtc
gccggcatcacggtcgggctggccgagggctggaccctggaccgggcggtgcgctacggc
atcgccgccgccaccgcgaagctgcagacgccggccacctcggtgttcgaccgcgccgac
gtcgagcaccacttcgccgagcagctggcaccgtcgggcacctga

DBGET integrated database retrieval system