KEGG   Mycobacterium vanbaalenii: Mvan_1394Help
Entry
Mvan_1394         CDS       T00449                                 

Definition
ribokinase-like domain-containing protein
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mvan_1394
   01230 Biosynthesis of amino acids
    Mvan_1394
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mvan_1394
   00030 Pentose phosphate pathway
    Mvan_1394
   00051 Fructose and mannose metabolism
    Mvan_1394
   00052 Galactose metabolism
    Mvan_1394
  Energy metabolism
   00680 Methane metabolism
    Mvan_1394
Enzymes [BR:mva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mvan_1394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1485463..1486407
Genome map
AA seq 314 aa AA seqDB search
MTPLSIVTLTMNTALDVAADADEVVPTEKVRCRAVRYDAGGGGVNVARFARVLGATVSAV
FTAGGSTGSRVIDMVEAAGVPGVPVPIEGATRESFTVNERATGKQYRFVLPGPVLSPGEE
ARCLEALRQAAYSAQFVVASGSLPPGVPLDFYQRVADMCREAGALLILDTSGGGLSHITS
GVYLLKPSVRELRECVGRPLPTEAEQLAAAHELIDRGIARIVVVSLGAQGALLAASSHSE
RFPALPVAAVSGIGAGDAMVAGITVGLAEGWTLDRAVRYGIAAATAKLQTPATSVFDRAD
VEHHFAEQLAPSGT
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgactcctctgtcgatcgtcacgctgacgatgaacaccgcactcgacgtcgccgccgac
gccgacgaagtcgttcccaccgagaaggtccgctgccgcgcggtgagatacgacgcaggc
ggcggcggcgtcaacgtggcgcggttcgcccgggtgctgggagcgacggtgtcggcggtg
ttcaccgcgggcgggtcgaccggctcacgggtgatcgacatggtcgaggcagcgggagtg
cccggtgtccccgttcccatcgaaggggcgacccgcgagagcttcaccgtcaacgagcgt
gccaccggaaagcagtaccggttcgtgctgcccggccccgtcctgagtcccggtgaagag
gcgcgctgtctcgaagcgctgcggcaggccgcgtactcggcgcagttcgtggtggccagc
ggcagcctgccgccgggggtgccgctcgatttctaccagcgggtggccgacatgtgccgg
gaggcgggcgcgctgctgatcctggacacctcgggaggcgggctgagccacatcacgtcc
ggtgtctacctgctcaagccgagcgtccgtgagctgcgcgagtgcgtcggacgcccgctg
ccgacggaggcagagcagctggcggcggcgcacgagctcatcgaccgggggatcgcccgg
atcgtcgtcgtgtcgctgggtgcgcagggcgcgctgctggcggcgtcatcgcacagcgaa
cggtttccggcgctgcccgtcgccgcggtcagtggcatcggcgccggagacgcgatggtc
gccggcatcacggtcgggctggccgagggctggaccctggaccgggcggtgcgctacggc
atcgccgccgccaccgcgaagctgcagacgccggccacctcggtgttcgaccgcgccgac
gtcgagcaccacttcgccgagcagctggcaccgtcgggcacctga

DBGET integrated database retrieval system