KEGG   Mycobacterium vanbaalenii: Mvan_1588Help
Entry
Mvan_1588         CDS       T00449                                 

Definition
putative succinate dehydrogenase
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mva  Mycobacterium vanbaalenii
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mvan_1588
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mvan_1588
   00650 Butanoate metabolism
    Mvan_1588
  Energy metabolism
   00190 Oxidative phosphorylation
    Mvan_1588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1682204..1682695)
Genome map
AA seq 163 aa AA seqDB search
MSSGKKMAENPYDHISDRGGPAPVMQRSYDRPAGLDNPRSPRRAGGMPNFEKYAWLFMRF
SGIVLVFLALGHLFIMLMWENGVYRIDFNYVAERWSSPFWQTWDLLLLWLAQLHGGNGMR
TIIADYSRKDSTKFWLNTLLALSMAFTLVLGTYVLLTFDATIS
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtgagttcaggaaagaagatggccgagaacccctacgaccacatcagcgaccgcggcggg
cccgctcccgtcatgcagcgcagctacgaccggcccgcagggctggacaacccgcgatcg
ccccggcgggccggcgggatgccgaacttcgagaagtacgcctggctgttcatgcgcttc
tcgggcatcgtcctcgtctttctcgcgctcgggcacctgttcatcatgttgatgtgggag
aacggcgtgtaccgcatcgacttcaactacgtcgccgagcgctggtcctcgccgttctgg
cagacctgggacctgctgctgttgtggctggcccagctgcacggcggtaacgggatgcgc
acgatcatcgccgactacagccgcaaggactcgacgaagttctggctcaacaccttgctg
gcactgtcgatggcgttcacgctggtcctggggacctacgtgctgctgacgttcgacgcg
acgatttcctga

DBGET integrated database retrieval system