KEGG   Mycobacterium vanbaalenii: Mvan_1990Help
Entry
Mvan_1990         CDS       T00449                                 

Definition
(GenBank) short chain enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mva  Mycobacterium vanbaalenii
Pathway
mva00071  Fatty acid degradation
mva00280  Valine, leucine and isoleucine degradation
mva00281  Geraniol degradation
mva00310  Lysine degradation
mva00360  Phenylalanine metabolism
mva00362  Benzoate degradation
mva00380  Tryptophan metabolism
mva00410  beta-Alanine metabolism
mva00627  Aminobenzoate degradation
mva00640  Propanoate metabolism
mva00650  Butanoate metabolism
mva00903  Limonene and pinene degradation
mva00930  Caprolactam degradation
mva01100  Metabolic pathways
mva01110  Biosynthesis of secondary metabolites
mva01120  Microbial metabolism in diverse environments
mva01130  Biosynthesis of antibiotics
mva01212  Fatty acid metabolism
Module
mva_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mvan_1990
   00650 Butanoate metabolism
    Mvan_1990
  Lipid metabolism
   00071 Fatty acid degradation
    Mvan_1990
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mvan_1990
   00310 Lysine degradation
    Mvan_1990
   00360 Phenylalanine metabolism
    Mvan_1990
   00380 Tryptophan metabolism
    Mvan_1990
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mvan_1990
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mvan_1990
   00281 Geraniol degradation
    Mvan_1990
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mvan_1990
   00627 Aminobenzoate degradation
    Mvan_1990
   00930 Caprolactam degradation
    Mvan_1990
Enzymes [BR:mva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mvan_1990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 SDH_sah Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ABM12809
JGI: Mvan1990
UniProt: A1T6K9
Position
2125713..2126474
Genome map
AA seq 253 aa AA seqDB search
MADEVLLERRDRVLIITINRPEARNAFNLAVAQGLADAMDELDSSAELSVAIITGAGGNF
CAGMDLKAFMAGEVPAIEGRGIGFTERPPRKPVIAAVEGYALAGGTEIVLATDLIVAAKN
AKFGIPEVKRGLVAAGGGLLRLQKRIPYQKALELALTGDSFTAEEASQWGFVNVLTEPGE
ALNGALALAERITANGPLAVAVTKEVIVKSADWTEAEMWKKQGELVMSVFSSKDAMEGAT
AFAEKRKPNWTGS
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtggctgacgaggttcttctggaacgcagggaccgggttctgatcatcaccatcaaccgt
ccggaggcgcgcaatgccttcaacctcgcggtggcgcaggggctggcggacgcgatggac
gaactcgacagctctgctgagctgtcggtggcgatcatcaccggggcgggcggcaacttc
tgcgccggtatggacctgaaagcgttcatggccggcgaggtgcccgcgatcgagggccgc
ggaatcgggttcaccgagcgcccgccacgcaagccggtgatcgccgcggtcgaggggtac
gcgctcgccggcggcaccgagatcgtgttggccaccgatctgatcgtggccgccaagaac
gcgaagttcggcatccccgaggtgaagcgcggcctggtggccgcgggcggcggtctgctg
cggctgcagaagcgcatcccctaccagaaggcgctcgaactcgcgttgaccggcgacagc
ttcaccgccgaggaagcctcgcagtggggcttcgtcaacgtgctgaccgaaccgggcgaa
gcgctcaacggtgcgctggccctggcggagcgcatcaccgccaacggtccgctggcggtc
gcggtgaccaaggaggtcatcgtgaagtcggccgactggaccgaagccgagatgtggaag
aagcagggcgaactcgtcatgtcggtcttctcgtcgaaggacgcgatggagggtgcgacc
gcattcgccgagaagcgcaagccgaactggacgggctcctga

DBGET integrated database retrieval system