KEGG   Mycobacterium vanbaalenii: Mvan_2116Help
Entry
Mvan_2116         CDS       T00449                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mvan_2116
   01230 Biosynthesis of amino acids
    Mvan_2116
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mvan_2116
   00030 Pentose phosphate pathway
    Mvan_2116
   00051 Fructose and mannose metabolism
    Mvan_2116
   00052 Galactose metabolism
    Mvan_2116
  Energy metabolism
   00680 Methane metabolism
    Mvan_2116
Enzymes [BR:mva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mvan_2116
Protein phosphatases and associated proteins [BR:mva01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Mvan_2116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2257728..2258759
Genome map
AA seq 343 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRTSYVRYGSSVVGFQDGWRGLLEDRRIQLSNDDRNDR
LLAKGGTMLGTARVNPDKLRAGLDQIKQTLEDNGIDVLIPIGGEGTLTAAHWLSEENVPV
VGVPKTIDNDIDCTDVTFGHDTALTVATEAIDRLHSTAESHQRVMLVEVMGRHAGWIALN
AGLASGAHMTLIPEQPFDVEEVCRLVKQRFVRGDSHFICVVAEGAKPAEGSMQLRQGGID
EFGHEKFTGVAQQLAIEVEKRINKEVRVTVLGHVQRGGTPTAYDRVLATRFGVNAADAAH
AGEYGMMVSLRGQEIGRVPLADAVRQLKLVPQSRYDDAAEFFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcggagtgctgaccggcggcggcgactgtcctggcctgaacgctgtgatcagg
gcggtggtgcggacctcgtatgtgcggtacggctcgtcggtggtcggcttccaggacggt
tggcggggcctgctggaggatcgccgtatccagttgagcaacgacgaccgcaacgaccgg
ctgctggccaagggcggcaccatgctcggtaccgcgcgggtgaaccccgacaagctgcgc
gccggcctcgaccagatcaagcagacgctggaggacaacggcatcgacgtgctcatcccg
atcgggggtgagggcacgctgaccgccgcgcactggctgtccgaggagaacgtccccgtc
gtcggtgtgcccaagacgatcgacaacgacatcgactgcaccgacgtgacgttcggccat
gacaccgcgttgaccgtcgccaccgaggccatcgaccggttgcacagcaccgcggaatcc
catcaacgcgtgatgctggtcgaggtgatggggcgccacgccggctggatcgcgctgaac
gccgggctggcctcgggtgcgcacatgacgctgatccccgagcagccgttcgacgtcgaa
gaggtgtgccggttggtcaaacagcgcttcgtgcgcggtgattcgcatttcatctgtgtg
gtcgccgagggtgcgaagccggccgaggggtcgatgcagctgcgtcagggcgggatcgac
gagttcggacacgagaagttcaccggcgtcgcgcagcaactggcgatcgaggtggagaag
cggatcaacaaggaggtccgggtgaccgtgctcgggcacgtgcagcgcggcggcacgccc
acggcgtacgaccgcgtgctggccacccggttcggcgtcaacgccgctgatgccgctcac
gccggcgagtacgggatgatggtgtcgctgcgcggtcaggagatcgggcgggtgccgctg
gccgatgcagtgcgccagctcaagctggtcccgcagagccgttacgacgacgccgccgag
ttcttcggctga

DBGET integrated database retrieval system