KEGG   Mycobacterium vanbaalenii: Mvan_2302Help
Entry
Mvan_2302         CDS       T00449                                 

Definition
magnesium chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mvan_2302
Enzymes [BR:mva01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Mvan_2302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2456939..2458855
Genome map
AA seq 638 aa AA seqDB search
MTSPESSPPIYPFSAVIGHDRLRLALVLCAVRPDIGGVLIRGEKGTAKSTAVRGLAHVLS
AAFAASGEHGGQLVELPIGATEDRVVGSLDLQKVLRDGEHAFSPGLLARAHRGVLYVDEV
NLLHDHLVDVLLDAAAMGRVHIERDGVSHSHDARFVLIGTMNPEEGELRPQLLDRFGLTV
DVAASRDVDVRVEVIRSRLAYEADPAAFAERYAAADADLAAQIAKARALIADVVLPDNEL
RRIAALCAAFDVDGMRADLVVARTAVAHAAWRVSATGAGEATGDVTVGEEDIRVAAELAL
PHRRRRDPFDDPGLDPDRLDEAMEQAGESVDGPPDPDPEPDPPGGGSNPDDVAEGQERQQ
KSSSPSGQSAPPAHTFKTRALVVPGVGEGAPGRRSRARNRTGTVIAATEDAGAGHGLHMF
ATLLNAAGRRRGPGAVRPGPDDVRRAVREGREGNLVIFVVDASGSMAARDRMSAVSGATL
SLLRDAYQRRDKVAVITFRRQDARVLLPPTTSVYIASRRLARFDTGGKTPLAQGLLAARD
MVVRERARDRARRSLVVVLTDGRATGGPDPLGRARAAAARLVAEGAAAVVVDCETSYIRL
DLAQDLARRLGAPSVRLDELRAENLTALVKAQADRGAA
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtccccggaatcgtcgccgccgatctatccgttcagcgcggtcatcggacacgac
cggctgcggctggcactggtgctgtgcgcggtgcggcccgacatcggcggagtgctgatc
cgcggcgagaagggcaccgcgaaatcgaccgccgtgcgcgggctggcgcacgtcttgtcg
gcggccttcgcggcgtccggtgagcacggcggtcaattggttgagctgccgatcggcgcc
accgaggaccgcgtcgtgggctcgctggatctgcagaaggtgctgcgcgacggcgagcac
gcgttctcgcccggtctgctggcgcgggcacatcgcggggtgctctacgtcgacgaggtc
aacctgctgcacgaccacctcgtcgacgtgctgctcgacgcggccgcgatgggccgggtc
cacatcgaacgcgacggcgtctcgcacagccacgatgcccggttcgtgctgatcggcacg
atgaaccccgaggagggagagttgcgcccacagctgctcgaccggttcgggctcaccgtc
gacgtggctgcctcccgcgacgtcgacgtccgcgtcgaggtgatccggtcccggttggcc
tacgaggccgacccggcggcattcgccgaacgctacgccgccgcagacgccgacctggcc
gcccagatcgccaaggcgcgtgcgctgatcgccgatgtggtgctgcccgacaacgaatta
cgacgcatcgccgcgctgtgcgcggcgttcgacgtcgacgggatgcgcgcggacctcgtg
gtggcgcgcaccgcggtggcgcacgccgcatggcgcgtttcggcgaccggggcgggcgaa
gcgacgggggatgtgaccgtcggcgaggaggacatcagggtggcggccgaactggcgctg
ccgcaccggcggcgccgcgacccgttcgacgaccccggtctggaccctgaccggctcgac
gaggcgatggaacaggccggggagtcggtcgacggcccgccggatccagatccggagcct
gacccgccgggcggtgggtcgaatcccgatgatgtcgcggaaggtcaagagcggcaacag
aagtcgtcatcgcccagcgggcagagcgcgccaccggcgcacacgttcaagaccagggcg
ctggtcgtccccggtgtcggggagggagccccgggtcgtcggtcacgcgcccgcaatcgc
accggcaccgtgatcgcggcgaccgaggatgccggggccggccacggcttgcacatgttc
gcgacgctgctgaacgcggcgggacgccggcggggtccgggcgcggtgcgtccggggccc
gacgatgtgcggcgcgcggtacgcgaaggccgcgagggcaatctggtgatcttcgtcgtc
gacgcctcggggtcgatggcggcccgcgaccgtatgtcggcggtcagcggtgcgacactg
tcgctgctgcgggatgcctaccagcgccgggacaaggtcgccgtcatcacgttccgccgg
caggatgcccgggtgctgctgccgccgaccacctcggtgtacatcgccagccggcggctg
gcccgtttcgacaccggcggcaaaaccccactggcacaaggtctgctggccgcgcgcgac
atggtggtgcgggaacgggccagggaccgcgcccgccggagcctggttgtggtactcacc
gacggccgcgccacgggcgggccggatccgctgggccgggcccgcgccgcggccgcccgg
ctggtggccgagggcgccgccgccgtcgtggtggattgtgaaacctcttacatccgactc
gatctggcgcaggatctggcccgccggctcggcgcgccgtcggtgcggctggacgagttg
cgtgccgagaatctgaccgctctggtgaaggcgcaggccgaccggggcgccgcgtag

DBGET integrated database retrieval system