KEGG   Mycobacterium vanbaalenii: Mvan_2381Help
Entry
Mvan_2381         CDS       T00449                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mva  Mycobacterium vanbaalenii
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mvan_2381
   00670 One carbon pool by folate
    Mvan_2381
Enzymes [BR:mva01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Mvan_2381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2537834..2538322
Genome map
AA seq 162 aa AA seqDB search
MTLSELNMVWAQSSSGVIGRGDAIPWHVPEDMARFKELTMGHTVIMGRLTWESLPAKFRP
LPGRRNVVVTRQAGYQADGAEVVTSFEDAPLDDAWVIGGSQIYGLALPLATRCEITEVDI
DLRREDDDALAPVLDEAWVGTEGDWRDSSSGLRYRFYSFVRK
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgagtgaactcaacatggtctgggcgcagtccagttccggggtcatcggccgt
ggcgatgcgatcccgtggcacgtgcccgaagacatggcccggttcaaggagctgaccatg
ggccacaccgtgatcatgggcaggctgacgtgggagtcgctgcccgcgaagttccgcccg
ctgccgggccgccgcaacgtcgtcgtcacccggcaggccggctaccaggccgacggggcg
gaggtggtgacgtcgtttgaggacgcgccgctcgacgacgcctgggtgatcggcggctcg
cagatctacgggctggcgctgccgttggcgacccgatgcgagatcaccgaggtggacatc
gacctgcgcagagaggacgacgacgcgttggcgcccgttctcgacgaggcgtgggtcggg
accgagggggactggcgcgacagttcgtcagggctgcgttaccggttctacagcttcgta
cggaaatga

DBGET integrated database retrieval system