KEGG   Mycobacterium vanbaalenii: Mvan_2667Help
Entry
Mvan_2667         CDS       T00449                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
mva  Mycobacterium vanbaalenii
Pathway
mva00230  Purine metabolism
mva01100  Metabolic pathways
Module
mva_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Mvan_2667
Enzymes [BR:mva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Mvan_2667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 CPT AAA_18 AAA_33 AAA_22 RsgA_GTPase MMR_HSR1 Cytidylate_kin AAA_29 Rad17
Motif
Other DBs
NCBI-ProteinID: ABM13474
JGI: Mvan2667
UniProt: A1T8H4
Position
2820348..2820959
Genome map
AA seq 203 aa AA seqDB search
MNEGGGPDSATGAAVLVLSGPSAVGKSTVVRCLRERVEDLFFSVSVTTRAPRPGEVDGVD
YFFVTAEQFQQLIDEGALLEWAEIHGGLHRSGTPAAPVRAAAAAGHPVLIEVDLAGARAV
KKAMPEATTVFLAPPSWEVLESRLVGRGTETPDVIARRLQTARDELAAQGDFDEVVVNGQ
LESACAELVSLLVAHTPVQHDQS
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgaaggcggagggccggacagcgctaccggggccgcggtcctggtgctgtccggc
ccgtctgccgtcgggaagtccaccgttgtccggtgcctgcgcgagcgtgtcgaggacctg
ttcttcagcgtgtcggtgaccacgcgcgcgccgcgtcccggagaagtcgacggcgtggac
tacttcttcgtgacggcagagcagtttcagcagctcatcgacgaaggcgccctcctcgaa
tgggcagagatccacggcggtctgcaccgttcggggaccccggcggcgcctgtgcgggcg
gcggccgcggccggccaccccgttctgatcgaggtcgacctcgccggcgcgcgggcggtc
aagaaggcgatgcccgaggccaccacggtttttctggccccgcccagctgggaggtgctg
gagagccggctcgtgggccgcggcaccgagacgcccgacgtgatcgcgcgccggttgcag
accgcgagggacgagctggcggcccagggagacttcgacgaggtcgtcgtcaacggtcaa
ttggagtctgcctgcgcggaattggtatccttgctggtggcccacacgccggtacagcac
gatcagtcctga

DBGET integrated database retrieval system