KEGG   Mycobacterium vanbaalenii: Mvan_2705Help
Entry
Mvan_2705         CDS       T00449                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mvan_2705 (tpiA)
   01230 Biosynthesis of amino acids
    Mvan_2705 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mvan_2705 (tpiA)
   00051 Fructose and mannose metabolism
    Mvan_2705 (tpiA)
   00562 Inositol phosphate metabolism
    Mvan_2705 (tpiA)
Enzymes [BR:mva01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mvan_2705 (tpiA)
Exosome [BR:mva04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mvan_2705 (tpiA)
  Exosomal proteins of bladder cancer cells
   Mvan_2705 (tpiA)
  Exosomal proteins of melanoma cells
   Mvan_2705 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2865466..2866251
Genome map
AA seq 261 aa AA seqDB search
MSRKPLIAGNWKMNLNHFEAIALVQKIAFSLPDKYFDKVDVTVIPPFTDLRSVQTLVDGD
KLRLTYGAQDVSQHDSGAYTGEISGAFLAKLGCTFAVVGHSERRTYHNEDDALVAAKAAA
AFKHGLTPIICIGEHLDVREAGNHVEYNVNQLRGSLAGLSAEQIGQAVIAYEPVWAIGTG
RVASAADAQEVCKAIRDELGNLASPELAAGVRVLYGGSVNAKNVGEIVGQADVDGALVGG
ASLDGEQFSMLSAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
ttgtcccgtaagccgctgatcgccggcaactggaagatgaacctgaaccacttcgaggcg
atcgcgctggttcagaagatcgcattctcgttgccggacaagtacttcgacaaggtcgat
gtcacggtcatcccgccgttcaccgatctgcgcagcgttcagacactggtcgacggcgac
aagctgcggctcacctacggtgcgcaggacgtgtcgcagcacgactccggggcctacacc
ggcgagatcagcggcgcgttcctcgccaagctcggctgcacgttcgccgtcgtcgggcac
tccgagcggcggacctatcacaacgaggacgacgcgctggtggcggcgaaggcggccgcg
gcgttcaagcacgggctgaccccgatcatctgcatcggtgagcacctcgacgtccgcgag
gccggcaaccacgtcgagtacaacgtcaaccagctgcgcggctcactggccggactgagt
gccgagcagatcggtcaggctgttatcgcctacgagccggtgtgggcgatcggcaccggc
cgggtggccagcgccgccgatgcccaagaagtctgtaaagcgatccgggacgagctgggc
aacctggcctcaccggagctcgccgccggtgtgcgggtgctctacggcggttcggtgaac
gcgaagaacgtcggtgagatcgtcggccaggccgatgtcgacggtgcgctggtcggtggc
gcgtcgctggacggcgagcagttctcgatgctgtcggcaatcgccgcaggcgggcctctt
ccctga

DBGET integrated database retrieval system