KEGG   Mycobacterium vanbaalenii: Mvan_2804Help
Entry
Mvan_2804         CDS       T00449                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mva01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:mva00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2972542..2973897
Genome map
AA seq 451 aa AA seqDB search
MVSVSVSPGLLRRIDLRGTTLSAARLRSALPRGGVDVDTVVPKVRPIVDAVAERGAAAAL
EYGAAFDGIRPDQVRVPAERLKAALAELDPDVRTALEVAIERARAVHADQRRTDTTTTLA
PGATVTERWVPVERVGLYVPGGNAVYPSSVVMNVVPAQTAGVDSLVIASPPQAGNAEPFK
GLPHPTILAAAALLGVDEVWAVGGAQAVALLAYGGVDTDGAELAPVDMITGPGNIYVTAA
KRICRSAVGIDAEAGPTEIAILADHTADPAHVVADLISQAEHDEMAASVLVTDSAELADA
TDRELAVQLETTVHRERVTAALGGQQSAIVLVDDIEAGIRTVNAYAAEHLEIQTVDAAAV
AGRIRSAGAIFVGPWSPVSLGDYCAGSNHVLPTAGCARHSSGLSVQTFLRGIHVVDYTEA
ALKDVSGYVITLAKAENLPSHGEAVRRRFER
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggtcagcgtgagtgtatcgccagggcttctgcggcgcatcgatctgcgcggcaccacg
ctgtcggcggcccgcctgcgctcggcactgccgcgcggcggtgtcgacgtcgacaccgtc
gtgcccaaagtcaggcctatcgtcgatgcggtcgccgagcgcggagccgccgcggcgctg
gagtacggtgccgcgttcgacggtatccggcccgaccaggtgcgggttcccgccgaaagg
ctgaaggcggcgctcgccgagctcgatcccgatgtccgcaccgcgctggaggtcgcgatc
gagcgggcccgcgccgtgcacgccgatcagcgccgcaccgacaccacgaccacactcgcg
ccgggcgccaccgtgaccgagcgctgggtgcccgtcgagcgggtcggactctacgtgccc
ggcggaaacgccgtctacccgtccagcgtcgtgatgaacgtggtgcccgcccagaccgcg
ggcgtggactcgctggtgatcgccagcccgccgcaggcggggaatgctgagcccttcaag
ggccttccgcatccgacgatcctggccgcggcggcgctgctcggtgtcgacgaggtctgg
gcggtcggcggggcccaggccgtcgcgttgctggcctacggcggcgtcgacaccgacgga
gccgaactcgctccggtcgacatgatcaccgggcccggcaacatctacgtcaccgccgcc
aaacgcatctgccggtcggcggtcggcatcgacgccgaggccggccccaccgagatcgcg
atcctggccgaccacaccgccgacccggcgcacgtcgtcgcggacctgatcagtcaggcc
gagcacgacgagatggccgccagcgtcctggtcaccgacagcgccgagttggccgacgcc
accgaccgcgagctggccgtacagctggagaccaccgtgcaccgcgagcgggtgacggcc
gcgctgggtgggcagcagtcggcgatcgtcctcgtcgacgacatcgaggccgggatccgc
accgtgaacgcctacgccgccgagcacctggagatccagaccgtcgacgcggccgctgtc
gcgggcaggatccgttctgccggagcgattttcgtcggtccgtggtcaccggtgagcctc
ggtgactactgcgcaggctcgaaccatgtgctccccaccgcgggctgcgcccggcattcc
agtggattgtcggtgcagaccttcctgcgcggcatccacgtcgtggactacaccgaggcg
gcgctgaaggacgtgtcgggctacgtcatcacgctggccaaggccgagaacctgcccagc
cacggcgaagccgtgcgccggaggttcgagcggtga

DBGET integrated database retrieval system