KEGG   Mycobacterium vanbaalenii: Mvan_2817Help
Entry
Mvan_2817         CDS       T00449                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mvan_2817
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mvan_2817
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mvan_2817
Enzymes [BR:mva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mvan_2817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2983348..2984610
Genome map
AA seq 420 aa AA seqDB search
MVDFAGPDLPRASAAVAEPTTHDPDARGHFGVYGGRYVPEALMAVIEEVTAAYEKARGDQ
TFLDELDRLQKHYTGRPSPVFEAERLSEHAGGARIFLKREDLNHTGSHKINNVLGQALLA
KQMGKTRVIAETGAGQHGVATATACALMGLECVIYMGAVDTARQALNVARMRLLGASVVA
VESGSKTLKDAINETFRDWVTNADNTYYCFGTAAGPHPFPMMVRDFQRVIGLEARAQMLD
QAGRLPDAVVACVGGGSNAIGIFHAFIDDPGVQLVGYEAAGEGVETGRHAATFTGGSPGA
FQGSYSYLLQDEDGQTIESHSISAGLDYPGVGPEHALLKDVGRAQYRPITDTEAMDALSL
LSRTEGIIPAIESAHAVAGALKLGGELGPGSIILVNVSGRGDKDVETAAKWFGLLEDGTK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgacttcgccggtcccgatctgccgcgcgccagcgcggcggtcgccgaacccacc
acccacgatcccgatgcccgcggtcacttcggtgtctacggcggcaggtacgtccccgag
gccttgatggccgtcatcgaggaggtgactgccgcctacgagaaggcccgcggtgatcag
accttcctcgacgagttggaccgcctgcagaagcactacacaggcaggccgtcgccggtg
ttcgaggccgagcggctcagcgagcacgccggtggagcgcggatcttcctgaagcgagaa
gatctcaaccacaccggatctcacaagatcaacaatgtgctcgggcaggcgctgctggcc
aagcagatgggcaagacccgggtcatcgcggaaaccggcgcaggccagcacggggtcgcg
acggcgacggcgtgcgcgctgatgggcctggagtgtgtcatctacatgggcgcggtcgac
acggcgcggcaggccctcaacgtggcccgcatgcggctgctcggcgcgtcggtggtcgcc
gtggagtccggctcgaagacgctgaaggacgcgatcaacgagacgttccgcgactgggtc
accaacgccgacaacacgtattactgcttcggtacggcggcgggcccgcacccgttcccg
atgatggtgcgcgacttccagcgcgtgatcggtcttgaggcccgcgcgcaaatgctggat
caggcgggccggctgcctgacgcggtggtcgcctgcgtgggcggcggttccaacgcgatc
ggcatttttcatgcgttcatcgacgatcccggggtgcagttggtcggctacgaggccgcg
ggcgagggcgtcgaaaccggccgccacgccgcgactttcaccggcggctcaccgggagcg
ttccagggttcgtactcgtacctgctgcaggacgaggacggtcagaccatcgaatcccat
tccatctcagcgggtctggactaccccggcgtcggtcccgaacacgcgttgctcaaggac
gtggggcgtgcccagtatcggccgatcaccgacaccgaagcgatggacgcgctgtcgttg
ctgagccgcaccgaggggatcatcccggcgatcgagtcggcacatgcggtggccggagcg
ctgaagctgggcggggagttgggaccggggtcgatcatcctggtgaacgtgtccggccgc
ggagacaaggacgtcgagacggcggccaagtggttcggtctgttggaggacggaacgaaa
tga

DBGET integrated database retrieval system