KEGG   Mycobacterium vanbaalenii: Mvan_2818Help
Entry
Mvan_2818         CDS       T00449                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mvan_2818
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mvan_2818
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mvan_2818
Enzymes [BR:mva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mvan_2818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2984607..2985395
Genome map
AA seq 262 aa AA seqDB search
MSRLAGLFDSCRAEGRSALIGYLPTGFPDVETSIAAMVALVESGCDLIEVGIAYSDPGMD
GPTIAAATEVALRGGVRVRDTFRAVEAITNAGGRAVVMTYWNPVLSKGVDAFARDLASAG
GLGLITPDLIPDEADEWLAASEAHDLDRIFVVAPSSTPQRLAETVQASRGFVYAASTMGV
TGARDAVSNAAPELVRRIKGISDIPVGVGLGVRSREQAAEIASYADGVIVGSALVSALKE
GIPAVRSLTEELADGVRQRITA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagccggctggctggattgttcgattcctgccgtgccgagggccggtcggcgctgatc
ggctacctccccacgggtttccccgacgtcgagacctcgatcgcggcgatggtcgccctg
gtcgagtccggatgcgatctcatcgaggtgggcatcgcgtattccgaccccgggatggac
gggccgacgatcgcggcggccaccgaggtcgcgctgcgcggcggcgtgagggtgcgcgac
acgttccgcgccgtcgaggcgatcaccaacgccggcggcagagcggtcgtcatgacctac
tggaacccggtgctgagcaagggagtcgacgccttcgcccgcgacctggcgtctgccggc
gggctcgggttgatcacccccgacctgatcccggacgaagccgacgaatggctggcggcc
tccgaggcgcacgacctggaccggatcttcgtggtggcgccgtcttcgaccccgcagcgg
ttggcagaaaccgtgcaggcgtcacgaggattcgtctatgcggcctcgacgatgggcgtc
accggggctcgtgacgcggtgtcgaacgccgcgccggaactcgtgcgccggatcaagggg
atctccgacatccccgtcggtgtcgggctcggggtgcgttcgcgcgagcaggccgccgag
atcgcttcctacgccgacggcgtcatcgtcgggtcggccctggtgtcggcgctcaaggag
ggtatccccgcggtgcgatcactgaccgaagagctcgctgacggcgtacggcagaggatt
actgcgtga

DBGET integrated database retrieval system