KEGG   Mycobacterium vanbaalenii: Mvan_2923Help
Entry
Mvan_2923         CDS       T00449                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mva01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mva00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mva00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3100673..3101974
Genome map
AA seq 433 aa AA seqDB search
MTEQLDATHPDLVTVKVPTHWYNLAAELDEPIPPHLHPGTREPVGPDDLAPLFASALIAQ
EVASETYIEIPQEVREIYAMWRPSPLIRARRFEKALNTGAHIYVKYEGVSPVGSHKTNSA
VAQAYYNHIDGVRKLTTETGAGQWGSALSFAGAQFGLEVEVWQVRASYESKPYRGHLIRT
YGGTVHSSPSTLTEAGRAILAKDPDTTGSLGMAVSEAVEVAAADPEARYALGSVLNHVVL
HQTVIGQEAVAQLALVEPDGADVVFGCAGGGSNLAGLSFPFLREKIHGRSNPRIVAAEPA
ACPSITRGEYRYDHGDVAGLTPLLKMHTLGMDFVPDPIHAGGLRYHGMAPALSHTVELGL
VEGVAISQHDAFAAGVQFARTQGIVPAPESTHAIAAAAAHVADDPREQVVVIGLSGHGQL
DLPAYAEYLDGKF
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacggagcagctcgacgccacccatccggaccttgtcaccgtcaaggttccgacgcac
tggtacaacctggcggccgagttggacgagccgatcccgccgcacctgcatcccggcacc
agggaaccggtcggcccggatgacctcgcgcctctgttcgccagcgcgttgatcgcgcag
gaggtggccagcgagacctacatcgagatcccccaggaggtacgggagatctacgcgatg
tggcggccgtctccgctgatccgcgcccggcgtttcgagaaggccctgaacaccggggcc
cacatctacgtcaagtacgagggtgtcagccccgtcggcagccacaagaccaactcggcg
gtggcgcaggcctactacaaccacatcgacggcgtgcgaaagctgaccaccgagaccggc
gccggacagtgggggagcgccctgtcgttcgccggggcccagttcggcctggaggtcgag
gtgtggcaggtccgcgcctcctacgagtccaagccctatcgcgggcatctgatccggaca
tacggcggcacggtgcactccagcccgtcgacgcttacggaggccggccgcgccatcctg
gccaaggatccggacaccaccggcagcctcggcatggcggtcagcgaggcggtcgaggtc
gccgcagccgacccagaggcgcgctacgcactgggaagcgtgctgaaccatgtggtgctg
caccagaccgtcatcggccaggaagccgtcgcgcagctggcactggtggagccggacggc
gccgacgtcgtcttcggttgcgccggaggcggttccaacctggccgggctgtcgttcccg
ttcctgcgggagaagatccacggccggtcgaacccgcggatcgtcgccgccgagccggcc
gcatgcccgtcgatcacccggggcgagtaccgctacgatcacggagacgtggctgggctc
accccactgctcaaaatgcacacgctcggcatggatttcgtgccggacccgatccacgcc
ggaggcttgcgctaccacggcatggcgccggcgctcagccacaccgtcgagctcggcctt
gtcgagggcgtggcgatctcacagcacgacgcgttcgccgcgggtgtgcagttcgcgcgg
acccagggcatcgtgccggcaccggagtcgacgcatgccatcgcggccgcggccgcgcac
gtcgccgatgatccgcgtgagcaggtcgtggtgatcggactgtccgggcacggccagctg
gatctgccggcctacgcggagtacctcgacggcaagttctga

DBGET integrated database retrieval system