KEGG   Mycobacterium vanbaalenii: Mvan_2923Help
Entry
Mvan_2923         CDS       T00449                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mvan_2923
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mvan_2923
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mvan_2923
Enzymes [BR:mva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mvan_2923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3100673..3101974
Genome map
AA seq 433 aa AA seqDB search
MTEQLDATHPDLVTVKVPTHWYNLAAELDEPIPPHLHPGTREPVGPDDLAPLFASALIAQ
EVASETYIEIPQEVREIYAMWRPSPLIRARRFEKALNTGAHIYVKYEGVSPVGSHKTNSA
VAQAYYNHIDGVRKLTTETGAGQWGSALSFAGAQFGLEVEVWQVRASYESKPYRGHLIRT
YGGTVHSSPSTLTEAGRAILAKDPDTTGSLGMAVSEAVEVAAADPEARYALGSVLNHVVL
HQTVIGQEAVAQLALVEPDGADVVFGCAGGGSNLAGLSFPFLREKIHGRSNPRIVAAEPA
ACPSITRGEYRYDHGDVAGLTPLLKMHTLGMDFVPDPIHAGGLRYHGMAPALSHTVELGL
VEGVAISQHDAFAAGVQFARTQGIVPAPESTHAIAAAAAHVADDPREQVVVIGLSGHGQL
DLPAYAEYLDGKF
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacggagcagctcgacgccacccatccggaccttgtcaccgtcaaggttccgacgcac
tggtacaacctggcggccgagttggacgagccgatcccgccgcacctgcatcccggcacc
agggaaccggtcggcccggatgacctcgcgcctctgttcgccagcgcgttgatcgcgcag
gaggtggccagcgagacctacatcgagatcccccaggaggtacgggagatctacgcgatg
tggcggccgtctccgctgatccgcgcccggcgtttcgagaaggccctgaacaccggggcc
cacatctacgtcaagtacgagggtgtcagccccgtcggcagccacaagaccaactcggcg
gtggcgcaggcctactacaaccacatcgacggcgtgcgaaagctgaccaccgagaccggc
gccggacagtgggggagcgccctgtcgttcgccggggcccagttcggcctggaggtcgag
gtgtggcaggtccgcgcctcctacgagtccaagccctatcgcgggcatctgatccggaca
tacggcggcacggtgcactccagcccgtcgacgcttacggaggccggccgcgccatcctg
gccaaggatccggacaccaccggcagcctcggcatggcggtcagcgaggcggtcgaggtc
gccgcagccgacccagaggcgcgctacgcactgggaagcgtgctgaaccatgtggtgctg
caccagaccgtcatcggccaggaagccgtcgcgcagctggcactggtggagccggacggc
gccgacgtcgtcttcggttgcgccggaggcggttccaacctggccgggctgtcgttcccg
ttcctgcgggagaagatccacggccggtcgaacccgcggatcgtcgccgccgagccggcc
gcatgcccgtcgatcacccggggcgagtaccgctacgatcacggagacgtggctgggctc
accccactgctcaaaatgcacacgctcggcatggatttcgtgccggacccgatccacgcc
ggaggcttgcgctaccacggcatggcgccggcgctcagccacaccgtcgagctcggcctt
gtcgagggcgtggcgatctcacagcacgacgcgttcgccgcgggtgtgcagttcgcgcgg
acccagggcatcgtgccggcaccggagtcgacgcatgccatcgcggccgcggccgcgcac
gtcgccgatgatccgcgtgagcaggtcgtggtgatcggactgtccgggcacggccagctg
gatctgccggcctacgcggagtacctcgacggcaagttctga

DBGET integrated database retrieval system