KEGG   Mycobacterium vanbaalenii: Mvan_3097Help
Entry
Mvan_3097         CDS       T00449                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mvan_3097
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mvan_3097
   00630 Glyoxylate and dicarboxylate metabolism
    Mvan_3097
Enzymes [BR:mva01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Mvan_3097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3264890..3267094
Genome map
AA seq 734 aa AA seqDB search
MTDRVTVGNLRVAPVLYDFINNEALPGTDIDPDTFWSGVDKVVADLTPRNQDLLARRDDL
QAQIDRWHRARVIGGFEPEDYKQFLTDIGYLEPEPADFSITTAGVDDEITTTAGPQLVVP
ILNARFALNAANARWGSLYDALYGTDVISDEGGAEAGSGYNPVRGDKVIAYARRFLDGAV
PLASGSWSDITGLKLDEGQLAATLDDGGTVGLGTPEQFVGYLGDAEAPTAVLLVNNGLHI
EILIDAEAPIGATDKAGIKDVVLESAITTIMDFEDSVAAVDADDKVLGYRNWLGLNRGDL
AEEVSKGGKTFTRVLNSDRTYTAANPGPDGATELTLPGRSLLFVRNVGHLMTNDAIVDAQ
GNEIPEGIQDALFTSLIGIHGLRTGDGNGPLVNSRTGSIYIVKPKMHGPDEVAFTCELFS
RVEDVLGLPQNTLKVGIMDEERRTTLNLKACIKAAADRVVFINTGFLDRTGDEIHTSMDA
GPMIRKGAMKSTEWIAAYENQNVDIGLETGFSGRAQIGKGMWAMTDLMADMVEQKIGQPR
AGATTAWVPSPTAATLHAMHYHEVDVFAVHNELAGTRRGTVDQLLTIPLAKELAWAPEEI
REEVDNNCQSILGYVVRWIDAGVGCSKVPDIHDVALMEDRATLRISSQLLANWLRHGVIT
EEDVKASLRRMAAVVDEQNAADPDFRPMAPDPDGSIAFQAAQELILSGADQPNGYTEPIL
HRRRREFKAASNVG
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcgcgtgacggtgggtaacctgcgcgtcgcccccgtgttgtacgacttcatc
aacaacgaggcgctgcccggcaccgacatcgaccccgacacgttctggtccggcgtcgac
aaggtcgtcgccgacctgaccccacggaaccaggatctgctggcccgccgcgacgatctg
caggcgcagatcgacaggtggcaccgggcgcgggtgatcggcggcttcgagcccgaggac
tacaagcagttcctcaccgacatcggctatctggaacccgagccggccgacttctcgatc
accaccgcgggcgtcgacgacgagatcaccaccaccgccggaccgcagctggtggtgccg
atcctcaacgcgcgtttcgcgctcaacgcggccaacgctcggtggggctcgctgtacgac
gcgctgtacggcaccgacgtcatctccgacgagggcggcgccgaggcgggaagcggatac
aacccggtgcgcggcgacaaggtcatcgcctacgcccgacgcttcctcgacggcgcggtt
ccgctggcgtcgggttcgtggtccgacatcaccgggctgaagctggacgagggtcagctc
gccgccacgctggacgacggcgggaccgtgggcctgggcacacccgaacagttcgtcggc
tacctcggtgacgccgaggcgccgacggccgtgctcctggtcaacaacggcctgcacatc
gagatcctgatcgacgccgaggcccccatcggcgcgacggacaaggccggcatcaaggac
gtcgtgctggagtccgcgatcaccacgatcatggacttcgaggactccgtcgccgcggtc
gacgccgacgacaaggtgctcggctaccgaaactggctcggcctcaaccgcggcgacctc
gccgaagaggtcagcaagggcggcaagacgttcacccgcgtgctgaactccgaccgcacc
tacactgcggcgaatcccggcccggacggcgcgactgagctcaccctgcccggccgcagc
ctgttgttcgtgcgcaacgtcggccacctgatgaccaacgacgcgatcgtggatgcccaa
gggaacgagattcccgagggcatccaggacgcgctgttcaccagcctgatcggtatccac
ggcctgcgcaccggtgacggcaacgggccgctggtcaacagccgcaccggttcgatctac
atcgtcaagcccaagatgcacggccccgacgaggtggccttcacctgcgagttgttcagc
cgggtggaggacgtcctcggcctgccgcagaacaccctcaaggtcggcatcatggatgag
gagcgccgcaccacgctcaacctcaaggcgtgcatcaaggccgccgccgaccgggtggtg
ttcatcaacaccggtttcctggaccgcaccggcgacgagatccacacctcgatggacgca
ggcccgatgatccgcaagggcgcgatgaagtccaccgagtggatcgccgcctacgagaac
cagaacgtcgacatcggcctggagaccgggttctccggcagggcccagatcggcaagggt
atgtgggcgatgaccgacctgatggccgacatggtcgagcagaagatcggtcagcccagg
gccggcgccaccaccgcgtgggtgccgtcgccgaccgcggccacgctgcacgccatgcac
tatcacgaggtggacgtcttcgcggtgcacaacgagctggcgggcacccgacggggcacg
gtggatcaactgctgaccattccgttggccaaggagctggcctgggcgcccgaagagatc
cgggaagaggtcgacaacaactgccagtcgatcctcggttacgtggtgcggtggatcgac
gccggtgtgggctgctcgaaggtccccgacatccatgacgtcgcgctgatggaggaccgg
gccacgctgcgtatctccagtcaactgctggccaactggctgcgccacggtgtcatcacc
gaggaggatgtcaaggcgagcctgcgccggatggccgcggtcgtggacgagcagaacgct
gcggatccggacttccggccgatggcacccgatccggacggcagcatcgcattccaggcg
gcccaggagctgatcctgtccggcgccgatcagcccaacggctacaccgagccgatcctg
caccgcaggcgcagggagttcaaggcggctagtaacgttggctga

DBGET integrated database retrieval system