KEGG   Mycobacterium vanbaalenii: Mvan_3175Help
Entry
Mvan_3175         CDS       T00449                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mvan_3175
Enzymes [BR:mva01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Mvan_3175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3378354..3380546
Genome map
AA seq 730 aa AA seqDB search
MLGVCNAASQGKIGAMSDDTAVPAALVELARRYGVASEYTDWTGRPVPVSAATLIAVLDA
LGVAAATEKDRAEALSRHERDHWARELPPSIVGRTGTAEPFWVHVTHGDPARLWLRLEDG
SVRTGLRQLENNRPPYDLDGRLVGEATFELPPDLPIGYHRLHLQVGSSDVSTIVIVSPST
LDRGTRLRADRAWGLATQLYSVRSGNSCGVGDLTDLTDLAVWSAARHHAGFVLVNPLHAA
APVAPMEPSPYLPTSRRFVNPMYLRVEAVPEFAYVRHRGRIRKAQAQVQARANRSERIDR
DSAWKAKRAALETLYLVGRSAGREIAYQAFRKREGHSLDDFATWCALAEHHGADWRQWPE
ELQHPRNEAVTAFVGDHHAEVDFHRWLQWLVDEQLSTAQDRAIQAGMELGIMHDLAVGVD
PDGADAWALQDALALGVTAGAPPDEFNQLGQDWSQPPWRPDRLAEAAYEPFRAMVGAILR
HAGGVRIDHIIGLFRLWWIPKGALPTEGTYVRYDHEAMIGIVTLEAHRVGAVVVGEDLGT
VEPWVRDYLRDRGLFGTSILWFEGDHDGDGGPLPAERWRQSCLSAVTTHDLPPTAGYLAG
EHVRLRDELGLLTRPAEEELAGDGAHQQAWMAELRRVGLLGGETPDVDEVVLALHRYLGR
TPSRLLALSLADAVGEVRTQNQPGTTNEYPNWRVPLAGPDGRQILLEDIFEDERAATLCE
AMRAAVEPRV
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
gtgctcggcgtttgcaatgccgcttcacagggcaagattggcgccatgtcggacgacact
gcagtgcccgcggctctggtcgagctcgcgcgacggtatggggtggcaagcgagtacacg
gactggacgggcaggccggtgccggtgtcggcggccaccctgatcgcggtgctcgacgcg
ctgggtgtggccgccgccaccgagaaggaccgcgccgaggccctctcccggcacgagcgc
gaccactgggcccgcgaactacctccctcgatcgtcgggcgcaccggcacggcggagccg
ttctgggtgcacgtcacccacggtgacccggccaggctgtggctgcgactggaggacggc
agcgtccggaccggacttcgtcagctcgaaaacaacaggccgccttacgatctcgatggg
cgactggtcggcgaagccaccttcgagctaccgccggaccttccgatcgggtatcaccgg
ctgcacctgcaggtgggttcgtccgacgtcagcaccatcgtcatcgtgtcgccgtccacg
ctggatcgcggtaccaggctccgggcggaccgcgcctggggcctggccacccagctctac
agcgtgcgctccggaaactcctgcggggtaggcgatctgaccgatctgaccgatctggcg
gtgtggtcggccgcgcggcatcacgccggtttcgtgctcgtgaacccgttgcacgccgca
gcgcctgtggccccgatggagccgtcgccgtatctgccgacgtcgcgacgcttcgtcaat
ccgatgtacctgcgggtggaggccgtgccggaattcgcctacgtccggcaccgcggtcga
atccgcaaggcgcaggctcaggtgcaggcccgcgcgaacaggtccgagcggatcgaccgg
gacagcgcctggaaggccaaacgagcggcactggagacgctgtatctggtcgggcgctcg
gcgggccgggaaatcgcctatcaggcgtttcggaagcgcgaggggcacagcctcgacgac
ttcgccacctggtgcgcactggccgagcaccacggggccgactggcggcagtggcccgag
gaactgcagcacccgcgcaacgaggcggtgaccgccttcgtcggggatcaccatgccgag
gtcgacttccaccgctggctgcagtggctcgtggacgagcaactgtcgaccgcgcaggat
cgggccatccaggccggcatggagctgggcatcatgcacgatctcgcggtcggcgtggac
cccgacggcgccgacgcctgggcgctgcaggacgcgctggcgctgggtgtgacggcaggc
gccccgccggacgagttcaaccagctgggtcaggactggtcgcaaccgccgtggcgacct
gaccggcttgcggaggcggcgtacgaaccgtttcgggcgatggtcggcgcgatcctccgg
catgccggtggggtgcggatcgaccacatcatcggcctgttccggttgtggtggattccg
aagggagcgctgccgaccgagggcacctatgtgcgctacgaccacgaggcgatgatcggg
atcgtcacgctggaggcgcaccgggtcggcgcggtcgtcgtcggggaggatctcgggacg
gtggagccgtgggtgcgcgattatctgcgcgaccgcgggctgttcggcacgtcgatcctg
tggttcgagggcgatcacgacggcgacggcgggccgctgccggcggaacggtggcggcag
tcgtgtctgtcggcggtcacgacgcatgacctgccgccgacggccgggtatctggcgggc
gaacatgtgcggctgcgtgacgaactcggactgctcacacgtccggccgaagaggagctg
gccggcgacggcgcgcatcagcaggcgtggatggccgagctgcgccgggtcgggctgctc
ggcggagagacccccgacgtcgacgaggtcgtgctggcattgcaccggtacctcggtcgc
acgccgtcgcggctgctcgcgctgtcgctggccgacgctgtgggcgaggtacgaacccag
aaccagccgggaacgaccaacgagtaccccaactggcgtgtgccgctcgcagggccggac
ggcaggcagattctgctggaggacatcttcgaggacgagcgcgctgcgaccctgtgtgaa
gcgatgcgtgccgcggtcgaaccgcgagtctga

DBGET integrated database retrieval system